STIRLING Front Load Washing Machine Instruction Manual

Front Load Washing Machine

6kg Front Load Washing Machine
Model Number SFLW6

IM Version No.: V1.1

INSTRUCTION MANUAL

Issue Date: 07/2019

MODEL: SFLW6 | PRODUCT CODE: 10018 | 07/2019

Welcome
Congratulations on choosing to buy a STIRLING® product. All products brought to you by STIRLING® are manufactured to the highest standards of performance and safety and, as part of our philosophy of customer service and satisfaction, are backed by our comprehensive 3 Year In Home Warranty. We hope you will enjoy using your purchase for many years to come.

2

MODEL: SFLW6 | PRODUCT CODE: 10018 | 07/2019

Contents
2 Welcome 5 Warranty 4 General Safety Warnings 5 Your Washing Machine 6 Installation Instructions 8 Washing Your Clothes 10 Quick Start Guide 11 Controls 12 Operating Your Washing Machine 14 Maintenance 19 Troubleshooting 22 Care Label 23 Technical Data 24 Repair and Refurbished Goods or Parts Notice 25 Warranty Returns

MODEL: SFLW6 | PRODUCT CODE: 10018 | 07/2019

3

This page is intentionally left blank

4

MODEL: SFLW6 | PRODUCT CODE: 10018 | 07/2019

6kg Front Load Washing Machine
The product is guaranteed to be free from defects in workmanship and parts for a period of 36 months from the date of purchase. Defects that occur within this warranty period, under normal use and care, will be repaired, replaced or refunded at our discretion. The benefits conferred by this warranty are in addition to all rights and remedies in respect of the product that the consumer has under the Competition and Consumer Act 2010 and similar state and territory laws. Our goods come with guarantees that cannot be excluded under the Australian Consumer Law. You are entitled to a replacement or refund for a major failure and for compensation for any other reasonably foreseeable loss or damage. You are also entitled to have the goods repaired or replaced if the goods fail to be of acceptable quality and the failure does not amount to a major failure.

MODEL: SFLW6 | PRODUCT CODE: 10018 | 07/2019

5

General Safety Warnings

· If the supply cord is damaged, it must be replaced by the manufacturer, its service agent or similarly qualified persons in order to avoid a hazard.
· The new hose-sets supplied with the appliance are to be used and the old hose-sets should not be reused.
· This washing machine is for indoor use only. · Do not install this appliance on a carpet surface. · This appliance is not intended for use by persons (including
children) with reduced physical, sensory or mental capabilities, or lack of experience and knowledge, unless they have been given supervision or instruction concerning use of the appliance by a person responsible for their safety. Children should be supervised to ensure that they do not play with the appliance. · Pull out the plug from the power socket before cleaning or maintenance. · Make sure that all pockets are emptied. · Sharp and rigid items such as coins, nails, screws or stones etc. may cause serious damage to this machine. · Pull out the plug and cut off water supply after the operation. · Please check whether the water inside the drum has been drained before opening the door. Please do not open the door if there is any water visible. · Pets and kids may climb into the machine. Check the machine before every operation. · Glass door may be very hot during use. · Keep kids and pets far away from the machine during use. · Take care that power voltage and frequency shall be identical to those of washing machine. · Do not use any socket with rated current less than that of washing machine. Never disconnect the power plug with wet hands. · To ensure your safety, the power cord plug must be inserted into an earthed three-pole socket. Check carefully and make sure that your socket is properly and reliably earthed. · Children of less than 3 years should be kept away unless continuously supervised. · Children should be supervised to ensure that they do not play with the machine. · Packing materials may be dangerous to children. Please keep all packing materials (plastic bags, foams etc) far away from children. · The washing machine shall not be installed in the bathroom or very wet rooms as well as in the rooms with explosive or caustic gases. · Make sure that the water and electrical devices must be connected by a qualified technician in accordance with the manufacturer’s instructions and local safety regulations.

· Before operating this machine,all packages and transport bolts must be removed. Otherwise, the washing machine may be seriously damaged while washing the clothes.
· Before washing the clothes for the first time, the washing machine should be operated once without the clothes inside.
· The washing machine with single inlet valve only can be connected to the cold water supply. The washing machine with double inlet valves can be connected to the hot water and cold water supply.
· Your washing machine is only for home use and is only designed for the textiles suitable for machine washing.
· Flammable and explosive or toxic solvents are forbidden. Gasoline and alcohol etc. shall not be used as detergents. Please only select the detergents suitable for machine washing, especially for drum.
· Do not to wash carpets. · Be careful of burning when washing machine drains hot
washing water. · Never refill the water by hand during washing. · After the program is completed, Please wait for two
minutes to open the door. · Please remember to disconnect water and power supply
immediately after the clothes are washed. · Do not climb up and sit on top cover of the machine. · Do not lean against machine door. · Please do not close the door with excessive forces. If it
is found difficult to close the door, please check if the excessive clothes are put in or distributed well. · The household washing machine isn’t intended to be builtin.
Cautions during Handling Machine
1 Transport bolts should be reinstalled when moving this appliance.
2 The accumulated water shall be drained out of the machine.
3 Handle the machine with care, do not lift with the machine door.
Usage Conditions and Restrictions
· Domestic use only: This appliance is intended for indoor household use only. It is not intended for industrial, commercial or trade use. Do not use it outdoors. Do not use it for anything other than its intended purpose (washing domestic quantities of laundry), and only use it as described in this manual.
Notes on disposal:
This product should not be disposed with other household wastes. To prevent possible harm to the environment or human health from uncontrolled waste disposal,recycle it responsibly to promote the sustainable reuse of material resources. To return your used device,please use the collection systems or contact the retailer where the product was purchased. They return and can take this product for environmental safe recycling.

6

MODEL: SFLW6 | PRODUCT CODE: 10018 | 07/2019

Your Washing Machine

Component
1 Detergent Drawer 2 Door 3 Detergent Box 4 Control Panel 5 Power Plug 6 Outlet Hose

Accessories

Transport hole plug

Hole plug (optional)

Inlet pipe, cold

Inlet pipe, hot (optional)

Outlet hose support (optional)

MODEL: SFLW6 | PRODUCT CODE: 10018 | 07/2019

7

Installation Instructions

Unpacking the washing machine Unpack your washing machine and check if there is any damage during the transportation. Also make sure that all the items in the attached bag are received.
If there is any damage to the washing machine during the transportation, or any item is missing, please contact the local dealer immediately.
Disposal of the packaging materials The packing materials of this machine may be dangerous to children. Please dispose of them properly and avoid contact with children. Please dispose of the related packing materials according to the relevant local regulations. Please do no throw the packing materials away together with other daily household waste.

Adjust Leg
1. When positioning the washing machine, please first check if the legs are closely attached to the cabinet. If not, please turn them to their original positions with hand or spanner and tighten the nuts with spanner.
2. After positioning the washing machine, press four corners on top cover of washing machine in sequence. If the washing machine is not stable when being pressed, this leg shall be adjusted.
3. Ensure the positioning status of washing machine. Loosen the lock nut with spanner and turn the leg with hand until it closely contacts with the floor. (Fig. 2) Press the leg with one hand and fasten the nut closely to the cabinet with the other hand.

Remove transport bolts (Fig. 1)
Before using this washing machine, transport bolts must be removed from the backside of this machine. Please take the following steps to remove the bolts:

1. Loosen all bolts with spanner and then remove them. 2. Stop the holes with transport hole plugs. 3. Keep the transport bolts properly for future use.

Fig. 2

4. After being locked properly, press four corners again to make sure that they has been adjusted properly. If it is still unstable, repeat Steps 2 and 3.
5. Ensure the machine is level, otherwise repeat steps 1-3.

Fig. 1
Select the location
Before installing the washing machine, please consider the location for the following; · Rigid, dry, and level surface (if not level, please make it
level with reference to the following figure “Adjust Leg”) · Avoid direct sunlight · Sufficient ventilation · Room temperature is above 0 C · Keep the washing machine away from combustible
materials. · Make sure that the washing machine does not sit on the
power cord. · Do not install the washing machine on carpet flooring.

Connect inlet pipe Connect the inlet pipe as indicated in figure 3. For the model which has hot valve, please connect the hot valve to hot water tap. Energy will decrease automatically for some program.
Fig. 3

8

MODEL: SFLW6 | PRODUCT CODE: 10018 | 07/2019

Installation Instructions Continued
Install inlet pipe
1. Connect the elbow to tap and fasten it clockwise. (Fig. 4)
2. Connect the other end of inlet pipe to the inlet valve at the backside of washing machine and fasten the pipe tightly clockwise. Notes: after connection, if there is any leakage with hose, then repeat the steps to connect inlet pipe. The most common type of tap shall be used to supply water. If tap is square or too big, then standard tap shall be changed.

Note: If the machine has outlet hose support, please install it like the following pictures.
1. When installing outlet hose, fasten it tightly. (Fig. 8 + 9)

Trough

Hose Retainer

Fig. 8

Min .60c m Max.100c m

Fig. 4
Hole plug (Fig. 5) This Hole plug is used to jam the hole on the back cabinet.

Bi n d
Max.100cm Min.60cm
Fig. 9
2. If outlet hose is too long, do not force it into washing machine as it will cause abnormal noises.

Fig. 5 Place outlet hose There are two ways to place the end of outlet hose:

1. Put it beside the water trough. (Fig 6)
   Fig. 6 2. Connect it to the branch drain pipe of the trough. (Fig 7)

Electrical Connection
As the maximum current through the unit is 10A when you are using its heating function, please make sure the power supply system (current, power voltage and wire) at your home can meet the normal loading requirements of the electrical appliances.
· Please connect the power to a socket which is correctly installed and properly earthed.
· Make sure the power voltage at your place is same to that in the machine’s rating label.
· Power plug must match the socket and cabinet must be properly and effectively earthed.
· Do not use multi-purpose plug or socket as extension cord.
· Do not connect and pull out plug with wet hand. · When connecting and pulling out the plug, hold the
plug tightly and then pull it out. Do not pull power cord forcibly. · If power cord is damaged or has any sign of being broken, special power cord must be selected or purchased from its manufacturer or service center for replacement.

Max.100cm Min.60c m

Fig. 7
Position outlet hose properly so that the floor will not be damaged by water leakage.

Warning
1. This machine must be earthed properly. If there is any short circuit, earthing can reduce the danger of electrical shock. This machine is equipped with power cord, which includes plug, earthing wire at earthing terminal.
2. The washing machine shall be operated in a separate circuit from other electrical appliances. Otherwise, the safety switch may be tripped or the fuse may be burned out.

MODEL: SFLW6 | PRODUCT CODE: 10018 | 07/2019

9

Washing Your Clothes

Checklist before Washing Clothes
Please read this section carefully to ensure proper use of the appliance and to avoid damaging your clothes.
Check first if clothes will be damaged by detergent Place your liquid detergent on a spare white towel and put this in contact with a hidden part of your colour clothing. Check if the towel takes on any of the colour. · When washing scarves and other clothes that easily
get decolorised, please wash them separately before washing.
Keep in Mind:
· Never leave clothes in the washing machine for prolonged periods of time, to avoid spotting and possible mould. The clothes also may get color changed or distorted if they are not washed according to the stated washing temperature. As for the stains on sleeves, collars and pockets, use the liquid detergent and wash it with a brush gently before washing.
Clothes that cannot be washed
Clothes that may get distorted being soaked in water or put through the washing machine cycle: · Ties, waistcoats, western-style clothes, outer garments
etc. may have obvious shrinkage if being immersed in water; the decolorized clothes such as blended spinning clothes of artificial fibre etc. · Wrinkle- style clothes, embossed clothes, resin clothes etc. may get distorted when being immersed in water. Among cotton and wool materials, the clothes that get easily distorted are wrinkle-style silk, fur products and fur decorations; · Clothes with decoration, long dress and traditional clothes etc are the products to get decolorized easily. · Please do not wash the clothes without material labels and washing requirements. · Never wash the clothes stained with the chemicals such as gasoline, petroleum, benzene, paint thinner and alcohol.

Please pay attention to detergents
· “Low bubble” detergent or washing powder or washing powder special for drum washing machine shall be selected according to fibre types (cotton, synthetic fibre, soft products and wool products), colors, washing temperatures, dirtiness and types. Otherwise, excessive bubbles may be generated and overflowed out of the drawer.
· Bleacher belongs to alkali type and can damage clothes, so it is suggested to use as little as possible.
· Powder detergents can easily leave the residues in the clothes so as to generate the bad smell, so they shall be sufficiently rinsed.
· Detergent can not easily get dissolved completely if there is too much detergent or water temperature is rather low. It can remain in clothes, pipes and washing machines to pollute the clothes.
· Washing shall follow the weight of clothes, dirtiness, local water hardness as well as the recommendations from the detergent manufacturers. Please consult the water company if you are not clear of water hardness.
Notes: Keep detergents and additives in a safe and dry place, away from children.
Please remove any items from all pockets prior to washing, otherwise your washing machine may be damaged.

10

MODEL: SFLW6 | PRODUCT CODE: 10018 | 07/2019

Washing Your Clothes Continued

For the clothes to be washed, they are classified according to the following characteristics:

The symbol types of care labels: the clothes to be washed are classified into cotton, blended fibre, synthetic fibre, silk, wool and artificial fibre.

· Color

White and colorful colors shall be identified. All new colorful articles shall be washed in a separately.

· Size

Articles of different sizes should be washed together to increase the washing effects.

· Sensitivity Soft articles shall be washed separately. As for new pure wool textiles, curtains and silks, the soft washing procedure shall be selected. Check the labels in all washing articles.

The clothes shall be sorted before being put into washing machine. As for the curtains with hooks, the hooks shall be removed before being washed. The decorations on the clothes may damage the washing machine. As for the clothes with buttons or embroideries, they shall be turned over before being washed.

Note: It is suggested that the parts that are easily stained such as white sockets, collars and sleeves etc. shall be hand washed before being put into washing machine to achieve more ideal washing effects. Please use powder or liquid detergents. The residues of the soap could remain in the gaps of the clothes if soap is used.
Confirm the washing capacity Do not overload the machine. Please see following table outlining capacity requirements for each material:

FIBRE TYPE
Cotton Synthetic Wool Delicate

MAX. LOADING CAPACITY (6.0KG) 6.0kg 3.0kg 2.0kg 2.5kg

The clothes which easily get fuzzed shall be turned over for washing The clothes which easily get fuzzed shall be washed separately; otherwise the other articles can be stained with dust and thrum etc. Preferably, black clothes and cotton clothes shall be washed separately because they can easily get stained with the thrums of other colors when being washed together. Please check before washing.

· Fasteners Zips shall be zipped closed and buttons or hooks shall be fixed. The loose band or ribbon shall be bound together.
It is suggested to put bras into the pillowslip with zip or buttons sealed to prevent the steel wire from popping out of bras into the drum and damaging the machine. Especially delicate textiles such as laced curtains, straight jackets, small articles (tight socks, handkerchiefs, ties etc.) shall be put into string bag for washing. When washing single, heavy items such as Turkish towels, jeans, jackets etc., it may cause the machine to become off balance and sound the error alarm. Therefore it is suggested to add one or two more clothes to be washed together so that draining can be done smoothly.

Do not wash
Waterproof materials (ski suits, outside napkin pads, curtains). With these types of materials, water cannot soak through easily so avoid washing. This may cause abnormal function, incorrect drainage or vibration within your washing machine and may harm your clothing.

Clean dust, stains and pet hairs from clothes
The clothes may be damaged and disturb washing effects during the friction between dusts, stains and clothes.

To protect baby skin
Baby articles (baby clothes and towels) including nappies shall be washed separately. If they are washed together with the adults’ clothes, they may be infected. Rinsing times shall be increased to ensure the thorough rinsing/ cleaning and to remove any detergent residue.

MODEL: SFLW6 | PRODUCT CODE: 10018 | 07/2019

11

Operate Washing Machine
Quick Start Guide
Quick start
1 Install the washing machine
2 LOopaedntthheeladuonodr raynd
3 Measure out the detergent
4 Close the door

10 PrreessssSthtaert[/sPtaaurts/epaBuusteto]n 9 Select the desired programme 8 PPrreessss Othne/OOfnf /BOuftfton 7 Plug the power supply

5 CPhuet cdkowthne(hdarnaginuppi)pteheisdirnasintaplliepde

6 Turn on the water tap

After washing:

After washing notes: 1.After washing, the washing machine will make the sound; 2.Close the water tap; 3.Press the On/Off and pull out the power plug.

1. After washing, the washing machine will beep to advise you the cycle is complete

2. Close the water tap

3. Press the On/Off button and pull out the power plug

12

MODEL: SFLW6 | PRODUCT CODE: 10018 | 07/2019

Controls

1

KEY

1. Program Selection knob 2. On/Off button 3. Delay button 4. Speed button 5. Temperature button 6. Start/Pause button 7. LED screen display

2

3

4

5

6

7

Program Selection knob There are 16 types of washing selection functions in display. They include:
­ Cotton intensive: With the corresponding temperature selections: 20, 30, 40, 60, 90º C, Cold
­ Cotton 60º C: Cotton 40º C; Cotton 20º C;
­ Rapid 15′: 20, 30, 40º C, Cold
­ Eco Wash: 20, 30, 40º C, Cold
­ Rinse & Spin
­ Spin only
­ Drain only
­ Wool: 20, 30, 40º C, Cold
­ Delicate: 20, 30º C, Cold
­ Mixed: 20, 30, 40º C, Cold
­ Synthetic: 20, 30, 40, 60º C, Cold
­ Sports: 20, 30, 40º C, Cold
­ Baby care: 20, 30, 40, 60, 90º C, Cold
­ My Program: customised program of your choosing
Notes: 1. The Control panel line chart is for your reference only.
Please refer to real product as standard. 2. The Control panel could be changed without written notice.
Please visit the website of Washing Machine or call up the service line for consultation.

MODEL: SFLW6 | PRODUCT CODE: 10018 | 07/2019

13

one round of the whole procedures without clothes in as follows:

1.Connect power source and water.

Operating You Washing Machine 234TII:I…h:PPPPeWBw1234PMurr :….eeeuidrtaWtafhesssoratCPPTPoiahsa- rsnhurreoudldieewsenitttntdsstwehBo1hh234TgIaenctedss:etaleelni.e…erhleoCretnCttPPsiPactthhWetfeehetbilrwbgtPhdueeoorlosrgieprenuereuretdretranbbgaeohssgordegtestsrauut ,dnetweteienusaecss- sttoaosedwtettndelpltnewrsoooshinnttrifcgtnroteaadnnththofgteshitoip”e”rtlrsveeeo””tenoeSrelOpaaOSlnnhwetusorfihbirbotttt,grdantnwis,nagaeactniustutw/niehr/heseOerdssntugOtftCtt:ed/tteieotathefnPotrce/faooconfwsrP”alaiptthwfr.shdnntlnsoua”sgwoaoateth.agsshfwofi”e”rtutromheobosShOaeauahpln”iwslonlleot.efttrlsoeetenxbgeaoaeawcs(riw”/.oFhabmwrdpsensO.niatx:drhgrtia/sdaaiotfoPa.nceicaf:snnfc1hc”arttnigsl.0gid.hreofnudo)sofseedpwsmifetlcutslroebtaoeihltisrwo”ao.motnwe.etsuxdcesserledter.ah:,wioribntmt.iiher.dtnhetoeaceopwcleu.okratasistfceeihledoiirtnot..hngceems

achine shall be in as follows:

opera

t

ed

i

n

1.Pull IoutIItP:hreeM-ddaeriatnewrdgeeenrt.teorrgweansthing powder

2.Fill 3.Fill

pdIIreet e- drWMgeaeat:eisnnWhrtdigniaeegntsentahrodtgideinCnintgaitvoaes/edCFdaaIbIist.riiecvesI o,(sfwtuehnceehrnans efacbersics asroyf)t.ener

or

tackOifpietiorn. 1

Option2

oN4p.oFtt2P1eiiol..suln:tsPF1doiule:fllttldp1eeorer.eungP- ttPeedeutnehrrultteglienitoenrdgttrundoeaottnweCwtt(ehpitaarn.eesotsohwrediCngrdgaaeeswmern()eaIwt.c(rw.hhoihinepneentntioo(nnFeniegcw2c.e(se1als0isqas)sruyha)i.driyn)).g machine.
– As3.forFitlhl de2e.atFegrigllelopnmtreine-trodaeCtetadesreogrIIe.ronpt yindteoteCragesnet Io(rwahddeintivnee,cbeesfosraertyh)e.y are pouredOipntitoon1the detergenOtpbtioonx2, it is su­ gOgp3et.isoFtneil1dl :dtdoeetueesrrgegesenotnm(pt eoinwwtdoaetrCe) rafsoer dIIil.ution to prevent the inlet of detergent box from being blocked
– Panl4ed.aosF­veiOlelcrspo4hfotlp.ioofoFttoweniinsoli2lenen:srg(s1iloniuwq:ftiuothdteiadiCelnb)eatleesefierrltlgiyinneptgeno(wwtoCh(afepadtneoesrnwte.eedcrgeesers(n)awt.ryfhoo).epr ntthionenev2ca(erliisoqsuuasidrwy)a)s. hing temperature to get the best washing Fig. 10

efNfeocttews:iNtPhloelateessess:cwhoaoteser asunidtaebnleetrygpye coof ndestuemrgpentitofno.r the various washing temperature to get the best washing effect with

Slestsawratt-eurAi tapsinsfdowserunatghegsregehyasgtcieogndnl ogstumommuepsrtaaeiotcesno.dhmoirenrwoepayt edr ef ot er rdgiel untti oonr

additive, before they are poured into the deterg to prevent the inlet of detergent box from being

ent box, blocked

CSotnanrteupctwtaahnsedhiponvogewmrfealorc.whCiinnhegewchkilief wfilalintegrwpaipteer.s are connected properly. Open the tap completely.

PCuot ninetch- tetPhcelelpoaotswheeecrs.hCtohooesbcekesifwuwiataastebhrleepditpyeapsneadorefficdlolenitnneertcghteeenddtpferootrpeterhrgelye.vnOatprieaonnutdshewtataacspkhciifonimegrpt.eleTmtehplyee. nrPauptturienresthtsoetcghleoetthtbehusetttbooebnset washing

“Owfunans/cOhtieofdnf”sa,enaSdfnefdeflilcepl tricnewtstishtthehthedleeepsbtersuortgwtpoeannettr”eaSprntaradorn/toc/drPeesadounfsueteer”nge.eysr.caTohnnedsnufpumrenpsctsitotihonen. s”Oann/Odffp” rbeusttsont.hSeelbecutttthoenp”roSptearrpt/roPcaeudusrees”.and

Select tShteaprtroucpewdausrheing machine

dTiSTihnrheteceilneoppcmerrtobsotpishnpeeaCPreotwipruoof rantwnoshwichnaneieinetsdhtgcchhutlpthiroenreetothgchcfoeleepoldlopsrtuwhorteieocnwsgessbewdhteraoau.lslwCrbhbeaieehnssgeswsehtcelhaeekmcasdtiphelfelidewnrbaadaetccuctoarseeomnerrtddalbpiebnfiilgcenipl.ttlaeoeitsndtihoaetanhrtcyeewcpceodi tsoreh,dntqteinuhnareeggncteiftttooineelstdtl,ohaapwennrddiotnydptgpiareteiwcnrslkeay,si.sfsqiOheoufirpant.hengTenthci tlteoihetnhesep,strateopnsbdcseotwmhaesphbleeduttetloyn.

temperat”uOren/tOabffl”e,.Select the proper procedures and functions and press the button “Start/Pause”.

9dT0SihreteinlpeerscospteotrfhtwScehStlaatoeuebptsbrhclhiebsrolio,oounccrtslngchoalyntesephttbserasdoeei,tnusocncsmae,rtbandipeerbtuucelwrehreeeencawsdlsot,hashtphibhteueslaed,rceltcoloinwlbtwotohecethnilotssseom,e,rbctlboeleoiniwdtcnteoetsanenlhtsd(eio,fooebarnrtefsclew)dacxxoisathr(mhfdeoptierhnleteegs:x)cftaooomflftlepohelweet:aitncybogplefefwesae,sqhuianngtities, and

temperatureMMtaoodbdeleerar.atetelylytobuegshmsitracihnse,dc,ocloluorrsf,ucl ofltatoxn, caontdtosnynatnhdetsicynatrhticelteics awrittihcles

60

cwerithaincedretacionlodreiscinoglodreizginreged(efogrrexea(mfoprle:xsahmirptsle, :psahjairmtsa, sn,igphutrepawjhaimteas;

40 20

,30 , , Cold wa

90 ter

liSnelinghtly

beSsemriiorcuhselyd,bpeusrmeirwchhieted,flpauxre white table cloths, canteen table cloths,

cotton or flax (for example: towels, bed sheets)

c

o

ffee

ENvoerymdaalylydbiMretyosdmceloirrtcahhteeesldy(faborertsiecmxleairsmc(hpfleoedr: ,escxyonaltmohrepftluiecl:faslanyxdn,twchooeotttiloc) nanadndwsoyonl)thetic articles

60

with certain decolorizing degree (for example: shirts, night pajamas;

Slightly besmirched, pure white flax

40 ,30 , 20 , Cold water

Normally besPm.1ir7ched articles (for example: synthetic and wool)

P.17

14

MODEL: SFLW6 | PRODUCT CODE: 10018 | 07/2019

Operating Your Washing Machine Continued

First: Turn the rotary switch to select the corresponding procedures according to the types of materials you are washing.
Second:
Select the proper temperature according to the dirtiness. Generally, the higher the temperature is, the more the power is consumed. Last:
Select the proper revolution spin speed. The higher the revolution spin speed is, the drier the textiles are spun, but the noise will also be increased.
PLEASE NOTE: to protect the clothes, select a lower revolution spin speed for delicate items. The main washing procedures depend on the types of the clothes to be washed as follows:

– Wool: You can select this procedure to wash the wool textiles labeled with “Machine Wash”. Please select the proper washing temperature according to the label on the articles to be washed. Furthermore, the proper detergent should be selected for wool textiles.
– Delicate: You can select this procedure to wash your delicate clothes. It is a is gentler wash with slower spin speed compared with the procedure “Synthetic”.
– Mixed: You can select this procedure to wash tougher clothes, that require more time to wash. It is used for daily clothes made of cotton, such as sheets, pillowcases, bathrobes and underwear.

– Cotton: You can select this procedure to wash the daily washable clothes. The washing period is quite long and is quite a strong wash program. It is recommended for washing dailycotton articles, for example: bed sheets, quilt covers, pillowcases, gowns, underwear etc.
– Cotton 60/40/20°C: You can select this procedure to wash daily clothes. The washing period is quite long with quite strong also. The temperature’s default is 60°C/ 40°C/20°C
– Rapid 15′: This procedure is suitable for washing few and not very dirty clothes for 15mins’.
– ECO Wash: As for few light dirty clothes, the maximum temperature of washing is limited to 40°C, and saving more energy.
– Rinse & Spin: Separate Rinse & Spin Procedure.

– Synthetic: You can select this procedure to wash the quite delicate clothes. The procedure is shorter compared with that for cottons and the wash is quite gentle. It is recommended to wash synthetic articles, for example: shirts, coats. As for curtains and laced materials, the “Synthetic” cycle should be selected. When washing knitted materials, reduce the volume of detergent used due to the loose nature of the clothes which create foaming bubbles more easily.
– Sports: You can select this procedure to wash your activewear.
– Baby Care: You can select this procedure to wash your baby’s clothes, it washes the baby’s clothes and the rinse performance is better to protect the baby skin.
– My Cycle: Press Speed button for 3sec. once you have selected your preferred wash settings for my cycle to save the memory of your favourite cycle.. The default my cycle is cotton.

– Spin Only:
Separate spin only procedure. Soap water or rinse water shall be drained out before spinning.

– Drain Only: Separate Drain only Procedure.

MODEL: SFLW6 | PRODUCT CODE: 10018 | 07/2019

15

Operating Your Washing Machine Continued

The main function can be selected as follows:
– Prewash: The Prewash function can get an extra wash before main wash.
– Express Wash: The function can decrease the washing time.
– Extra Rinse: The laundry will undergo extra rinse if you select it.
– Delay: Delay function can be set with this button, the delaying time is 0-24H. Set the delay function:
1. Select a program; 2. Press the Delay button to choose the time; 3. Press Start/Pause to commence the Delay operation. Cancel the Delay function: Press the Delay button until the display shows 0H. It should be pressed before starting the program. If the program is already started, you should press the On/Off button. Notes: If there is any break in the power supply while the machine is operating, a special memory stores the selected program and when the power is restarted, press the Start/Pause button and the remaining time will continue.

– Turning off alarm noise:
This is an additionalfunction on your appliance. After deactivating the alarm noise function, the noise will no longer sound.
After starting the machine, press the “Temp” button for 3 seconds and you will hear a beep, then the alarm noise will turn off. To restart the alarm noise function, press the “Temp” button again for 3 seconds. The setting will be kept until the next reset.
Warning: After deactivating the alarm noise function, the sounds will not be activated any more.
– Bubble Removal Function:
Bubble Check Function: Residual bubbles will form when there is excessive detergent, which will affect wash and rinse programs This functionwill check for additional bubbles automatically and thebubble removal procedure will be added automatically to remove bubbles when excessive bubbles are found.

Child Lock
To avoid children from operating the washing machine during use, you can select this function, In this case, all other buttons except On/Off button will not work, in this state, the machine will only power off when you press the “ON/OFF” key. Once the “ON/OFF” button is selected again, the machine will remember the child lock and the program which was selected before the machine was powered off. Press the “Temp” and “Speed” buttons together for 3 seconds during the running procedure, the buzzer will beep, the Start/Pause button as well as the selector switch are locked. Press the two buttons for 3 seconds together again and the buzzer will beep to release the child lock.

16

MODEL: SFLW6 | PRODUCT CODE: 10018 | 07/2019

Operate Washing Machine
Operating Your Washing Machine Continued

WasThaingbPlerocoeefdWureas shing Procedures

Load(kg) 6.06.07.5

Default Default Time Temp.( C) (Min)

Softener Case

6.60./07.5

6.06.0 a7t .5 12102000r1p4m00

120012001400

Cotton Intensive 6.06.07.5

40 1:581:581:58 100010001000

60° 6.06.07.5

60 4:364:364:41 120012001400

40° 6.06.07.5 20° 6.06.07.5

40 1:251:251:25 120012001400 20 1:131:131:13 100010001000

Quick 15′

2 . 02.0 2 . 0

Cold 0:150:150:15 800 800 800

Eco Wash 2.02.02.0

30 1:061:061:06 800 800 800

Rinse&Spin 6.06.07.5

–

0:310:310:31 100010001000

Baby Care
Sports

6 . 06.0 7 . 5 3.03.0 3.5

60 1:391:391:39 100010001000 40 1:191:191:19 800 800 800

3.03.0 3.5

40 1:331:331:33 120012001200

Mixed

6.06.0 7.5

40 1:131:131:13 100010001000

Delicate

2.52.5 2.5

30 1:001:001:00 600 600 600

Drain Only Spin Only

2 . 02.0 2 . 0 — 6 . 06.0 7 . 5

40 1:061:061:06 400 400 400

–

0:010:010:01

000

–

0:120:120:12 100010001000

Means must
EnMeearngs yoptteiosntalprogram: Cotton

60 , Speed: theEhneirgghy etesstt psropgeraemd:;COottthoner60aºsC,thSpeedede:ftaheuhltig.hest

Means not necessary
Half load for 6.0/7.5Kg

machine:3.0kg/3.75s3pK.0ekgegd..;

Other

as

the

default.

Half

load

for

6.0Kg

machine:

NTrwws”ehoifuteeCahteripesttsohnaahetrcbatieponm.laenTgerahtetm6epors0aerctcoinetlurgetsahrlaiinasp”natmaaabrbnarosmleeovetearottmrmeherweseoannmhtl”lilyoaisycnyftoebhsardeonuttdshaidilefbeefarel’esdrr.iendnctfcoootrtmtotonantliao6un0″ftinsooCirdnowsttuhrht”tyieoithcanpahabep6rltneop0hl”readtgooiibpsrntcrafhteilohaemarletamenat”msasnntttthaoiaeodnrnenmddatyiaaahnnrlrdldaetydhsrcsefaeootilnhitcaltdetboehhdentehlecs6eroe0trmwtla”eatoatpnloensarsdhosl,taiganteturhganresimsddpf,rrwafyotieagncassrnidtaheedmdtnishtey are

programmes in terms of combined energy atahnneddmwowastetaretcfefoicrniescnuotmpnprtsoiogunramsmfopirntwitoearnsmhssinogfoftchroawmt tbaypinseehdoifencngoetrtgtohynat type

cotton laundry,that the actual water temperatluaurendmry,atyhedaicffteuarl fwraotmer ttehmepedraetucrleamreayddcifyfecrlferotmetmheperatu

Means must

declared cycle temperature.

Means optional

Means not necessary

Notes: The parameters in this tableMaOrDeELo: SnFlLyW6fo| PrRuOsDeUCr’TsCrOeDfEe: 1r0e0n18c|e07./2T01h9e actual par1am7 eters

maybe different with the parameters in above mentioned table.

orine-free detergents.

ver use steel wool.

Maintenance Dispose a Frozen Washing Machine
hen the temperature drops below zero and your washing machine gets frozen, you may:

Disconnect the power supply for the washing machine.

Wash tBheefotreapunwdeitrthakwinagramnywmaatientrentoanlcoeo, spelenasienpleutll pouipt eth.e Anti-freeze ake dpoowwneripnlluegtopridpisecaonnndecimt pmoweerrsaenditcilnoswe athremwwataertetarp.. If your washing machine is in a room where it can get
PRoeucrownW- naeArDmRcotNwiInnNoalGtet!uetsrpeiinpanteoytswooaltvhseehntitsna,gpasdatrnhuedmycmahaneydcdkwamwaahitgefeothtrhee1r0inmleintfpruaioptnzeeedsnan.oeduasitnillleye,ttppaleirpaeesetwhdoorrarokiunignthhgley.nreomraminainlglyw. ater inside drain
es: whenmthacehwinaes, hcianugsemtaocxihcingeasiessreour sceauds,emaankeexspulorseiothn.e ambRieemntotveemtpheerraetmuraeiniisngabwoavteer0inCinlet pipe:

Anti–fNreeveerzusee water to sprinkle and wash the washing

1. Turn off the water tap.

oruermwa- ainsImcithlneaiisgancnfhgowitnrmhbaeei.tdaewdcreahinsnihntsioneigduisesmealddocrechatiaeninrtege.pedniptisnectaohnnetdarinoinionlgemtPwpCiMhpeXertteohiot rcoa23u..nggScShoctelaynrter.ttawfurinopoezfraf.ent(hFyneigpei.rnoa1lec1ste)idplyuip,reepfelrexocmaespteat psdianrngadleinpWuat siths

end into or Drain

a

move the remaining water in inlet pipe:

procedure. Any water will be drained out of inlet pipe

Close Cthleeantainpg. & Maintenance of Washing Machine Cabinet

for about 40 seconds.

ScrewPoroffptehr emaininlteent apnicpeeofnrothme wtaasphainngdmpacuhtinitesceanndexitnentod the4c. oRnetcaoinnneerc.t the inlet pipe to tap. Srtoacrteudintpthusoernawre- enoa.ibyrsWkriaapnansgriyotvleeiwcfernea.wetdTeuhirutlreolravebsleudeerrefflxdtaoeccwrreage, eiucpnnsatteenssdabwiwneohgeceutllnetecanolonWeftechidaentssowlsehaiwttrhoiypp.dreiIifplDuitetroeadfiffinany

or aboimumt 4ed0iastelcy.oAnvdoisd.the use of sharp objects.

ReconNnoetecst:tfhoermiinclaectidpaipnde itso dtialupte.d solvents or equivalent

moveartehfeorbreidmdean.ining water in drain pump

Clean Internal Drum
Rustleft inside the drum by metal articles shouldbe avoid rbeumronvinedg,imit mshedailal tbeelydwoitnhecahlfoterinr eth-fereheodtewteargteenr ts. de theNmevaecrhuisneescteoeol lwsodool.wn.
Defrosting a Frozen Washing Machine When the temperature drops below zero degrees Celsius and your washing machine is frozen, you maPy:.22 1. Disconnect the power supply from the washing
machine. 2. Wash the tap with warm water to loosen inlet pipe. 3. Remove inlet pipe and immerse it in warm water. 4. Pour warm water into washing drum and wait for 10
minutes. 5. Reconnect inlet pipe to the tap and check whether the
inlet and outlet hoses are working normally.

Fig. 11
Remove the remaining water in drain pump
WARNING! To avoid burning, it shall be done after the hot water inside the machine cools down.

Note: when the washing machine is reused, make sure the ambient temperature is above 0°C

18

MODEL: SFLW6 | PRODUCT CODE: 10018 | 07/2019

wfnet.hTehaersrouwrfalocceactaionn on softener cover

Inlet filter shall must be cleaned if there is not any o

danrtay.ewInfetrah. enrce eis any

insufficient water in when the tap is opened.

peumpsaManardienttaeanlklaonewcoeeuCdtontsotoinfuteedner cover and wash Clean the tap filter:

s with water.

1.Close the tap.

heCsloefaCtleneandneedretcteeorrgvgeeenrtnabtonxbdaonpxdugsarhonodtvheges r(dFoirgoa. 1wv2ee) sr into 2.Select any procedure except “Wash” or “Drain”

Clean dCeletaenrgdeetnertgdernat wdrearwaernadngdrgorooovveess

procedure.

mhn..aiPLmlnlierslfeetimtdsdth12sefiu..eaidtslhtcotteelPiLwniebliprsfdyenteirrsduttwahsephcewdtielahtcoeehenlawirapd.rdnnrrutoatpaehwwekdaeenalro.idrofrcotutaawhtktiesleoooocrnfeautotteioisnnsnoesfnotorenonfctseoteorvanfcteeenornvryeeacrrnoocadvronevdwerwar sash3h.pPrroecsesdtuhreebruutntonnin”gSftoarrta/Pboauuts4e0″

and sec

keep onds.

t

h

e

waalltgerroionvewalslhgwerointohvtewhsaewtiethar.wpaitser.opened.

4.Remove the inlet pipe from the tap.

3etp.apRtsofpeisl.fstirtte3ooio.rrz:nee.tRpnhoe,essiyttsoiooorenuf.ttehmenesaoryfct:eonveer rcoavnedr

apnudsphusthhethderdarwaweerrinintt5oo.Use 6.Rec

water onnec

t t

o wash the filter. the inlet pipe.

y pCrloecCaelnedauinnrinelleeettxffilciteletrpetr “Wash” or “Drain”

Washing the filter in washing machine:

c e Cnnb.lsleueuattftnffoiiclTwCttnhiehlaeeeert”naesSitnrtnahlfwtteiphalatlaielnffrltiigtltlemtat/eewrpPrurihfsnsa:iehlttnuweobrutsh:heldeecnb”tlaeeatphacnilensedaetonadpkepeeidnfieesitfhdpto.ehpetrhreeeneiisse

ninosut faficniyenotr d.

.rCulonsn1ei.nthgeTuftoranrpo.affbthoeutatp4. 0 seconds.

1.Screw off the inlet pipe from the machine.
2.Pull out the filter with long nose

backside of the pliers and reinsta

he.eSweinloel2cre.kttaipnnSigypelpneecrootfracomneymdapulrtrlohyec.eeedxtucareeppe.xtc”eWpta”sWha”sohr” “oDr “rDairnai”n” it back after being washed.

Wa233ue4w5utetteeattast.tln…e….a.etthprmphiRpUaRSPrPROCaifleotoemtwttttalpiferrsherpcubrhseyhbelaalpiroofdoeistwfehl,reuglmctea.csceeaeinetcclieassiweriitnoreonhcsnanoeewlinh3456W12345loaaewdres.iriynnnlknirat………ntguddnsrevbnedatwwia,ttnnnegthoeontubauwthelhhleotsttapteeeeeeheefmhtCrrfrwheeae.trpPpRURSmPbROlvwfhtptwieeekclcttrretilhertecrraptrcueetoeeensapebht.ata.ootibeehacthapcpelrraalrmeccsongapkfecolautccseotefu0kkpifeleooahspinbhohiissloeewwoiovienettpsnlptcnnwgtlneoaiuthe.ddteehCatvifetnhttaehuhonnadennefehaeteolxhieeuuefaneinttreeeee.ilsiinnereerifelettnrrrrn.ntt.ns.fnethdfccgeegitdorrdutgehiinstaawil”e”thltte.algtogptasbertheretrSmSm.rrpottonauwenppwiodfeeianhhttnt.etfitiwp.ntrmhlanaifooipwheedaptoanpaaiipnteeritnlideonaktregnnatssifriieihivlrealnn/inhpppteeodtssfanhPsfehtwwwlln/geertcehpeeieefgnuhhPbaemolsiraipttiaeto.ssnfh.tpugtperoosdebuoameshhippasrspgoeerpihrudlm.rhuerkhniiraenloiepp.eeoaffcetetemies”oifrfceenhdtenbitftos4iooetlsnreb..srghh.tgrakoeiohm:ue0su”sseveuennmcesvmernrtt.atetestthaaopdoenirbohaae4ntddeestiprlhenn.racoh0nidenwcreee.saheictdeactasosdparrkibaknne:neoonasplwenridatsceet.ddihfvencaeooseirekds(ksetennpiyFenwrwsh.nerdaneidorigtldosnaeaspihoe.wnt.redtrthsefet1aeaathort3ehioterekhfnle)illtnferasehistlegattaaekellllra.NIr345itifgen..o.oepROCtwn.eeelplaaosyFcest:isgteohnGhe.dni1enet.t2nhgnhfieeelemtcretatataralctlpiphynh,.eaiwntnhieanedswlhtemaiiltnplapbgfkeiimlpetweeasra.cuishsrhienweeadths.isehweredasifsihrsentdoa,

water lea
nd then the then the st

efirltinerw:ashing machine is washed, then the steps 1~3 in cleaning the tap filter shall be

Npo.tes: GNoentee:rGalelyn,etrhaellyt,athpefitlatepr fiisltewraisshweadshfierdstfiarsntdatnhdenthtehnethfielter in washing machine will be washed.

eroponeclayettehfIdifdletuo.enfrrilleyitneterwheixansfciwhlteieanrpsgihntmin”waWgcahsmahinaisnecghhwim”inlloeabcriehs”iwnwDeaasrisshaheweidnad.s”, htheed,ntthheen

steps the

1~3

i

n

c

leani

ng

the

ta

p

fil

t

er

s

hall

be

steps 1~3 in cleaning the tap filter shall be repeated.

utton “Start/Pause” and keep the

unning for about 40 seconds.

inlet pipe from the tap.

o wash the filter.

P.23

he inlet pipe.

lter in washing machine:

e inlet pipe from the backside of the

filter with long nose pliers and reinstall

being washed. he inlet pipe.

P.23
P.23

p and make sure there is no water leakage.

p.

y, the tap filter is washed first and then the filter in washFiign.g13machine will be washed. n washing machine is washed, then the steps 1~3 in cleaning the tap filter shall be

MODEL: SFLW6 | PRODUCT CODE: 10018 | 07/2019

19

Maintenance Continued Pull out the power plug to avoid electrical shock before washing.
After using the washing machine, pull out the power cord and close the door tightly to avoid
pWiAnRcNhIiNnGg!the kids. PullRoeutmthoevpeowfoerrepliuggntomavaotitdeerlsectrical shock before washing. DAfrtearinusPinug mthepwFaislhtienrg:machine, pull out the power cord and close the door tightly to avoid injuring people.
DRreaminovpeufmorpeigfinltmeracttaenrsfDiltreairntPhuemyparFnilstear:nd small foreign matters from the washings. CThleeadnratinhepufmiltpefriltpeer criaondfiilctearllliynttaonednosthuerresmthaell nfoorerimgnaol bojpecetrsafrtoiomnthoef wwaasshhinigngmamcahicnhe.inCele.an the filter periodically
to ensure normal operation of washing machine.

WARNING!

AaDrenecgpdcueolacnrrdldleyiin.angngottnhotehthefieldtiesrtroinrieleslgesuvolefaleralwyc.ihthciyncltehaencdytchelefsreaqunedncthyeofftrheeqcuyecnlecsy, yoofutmheusct yincslpeesc,tyaonud chlaeavnethtoe fiinltsepr ect
TThheeppumump sphosuhlodubledinbsepeicntsepdeifcttheedmiafcthhineemdoaecshnionteemdopteysanndo/toresmpipn;ty and/or spin; TThheemmacahcinheinmeakmesakanesunaunsuualnnuosisueadlunriongisderadinuinrigndgudertaoionbinjegctsdusuechtoasosbajefectytspisnus,cchoianss seatcf.ebtylocpkiinnsg,thceopinusmp. etc. blocking the pump. TPhroeceSeedravsicfeo_llopwasn:el proceed as follows:

11..AAfftteerrththe epopwoewr ies rdiiss- dcoisnn-ected, conusneehcatneddto, uospeenhthaenfdiltetrocover. op(eFnig.th14e) filter cover.

22..TTuurrnnthtehfeiltfeirlteo ropdeonwans sahsown sha(oFnwigd.nt1a5wk)eitohutthaney ffiogreuigren maantdter. take out sundries matters.

33..RReeininstsatllaelal cehapcahrt pbaacrkt abfatecr k aftf(eFoirrge.sig1un6n)mdartiteesr ismraemttoevresd.are removed.

WFiga.r1n4ing!

Fig. 15

Fig. 16

When the appliance is in use and depending on the programme selected there can be hot water in the

pWuAmRpN.INNGe!ver remove the pump cover during a wash cycle, always wait until the appliance has finished tWhehecnycthle,aapnpdliaisnceemispitny.uWsehaenndrdeepplaecnidnigngthoen cthoevepr,ogernasmurseeliet cistesdetchuerelycarnetbigehhtoetnwdatseor.in the pump. Never

remove the pump cover during a wash cycle, always wait until the appliance has finished the cycle, and is empty.

When replacing the cover, ensure it is securely tightened

P.24

20

MODEL: SFLW6 | PRODUCT CODE: 10018 | 07/2019

TrTourobluesbhloeosthinog oting

Troubles

Reason

Solution

Washing machine cannot start up

Door cannot be opened

Machine’s safety protection design is working.

Check if the door is closed tightly. Check if power plug is inserted well. Check if water supply tap is opened. Check if button “Start/Pause” is pressed. Check if button “On/Off” is pressed.
Disconnect the power.

Heating fault

NTC is damaged and heating pipe is aging.

WCCOSoahannsanlthyalnlccccotlaoo.rnstmnhunteapaoslpctlyoutwrstwtahinpasegrhsoshcmweotrpilhtvdtheliycwhceaelsocahtethinnetgse..r promptly.

Water leakage

The connection between inlet pipe or outlet hose and tap or washing machine is not tight. Drain pipe in the room is blocked.

Check and fasten water pipes. Clean up outlet hose and ask a specialized person to repair it when necessary.

Water is overflowiendg from the bottom of the machine
Indicator or display does not light.

The inlet pipe is not connected firmly. Outlet hose ihsalesawkaintge.r leakage.
Power is disconnected. PC board has problems. Harness has connection problem.

Fix the inlet pipe. Replace the drain hose.
Check if the power is shut down and power plug is connected correctly. If not, please call suuppspeorvt ice line.

Detergent
residues in the dbisopxenser

WaWnaadsshahigninggglpopomowewdrdeaerteirsdisw. detaomrpcelongegded

CCleleaannaannddwwipiepethtehedisbpoexn. ser drawer. UUsseelilqiquuididdedteetregregnetsntosr othrethdeetdeergtenrgtsesnptsecial
fsopr edcruiaml for drum.

Washing effects ianreeffincoietngtloyod

The clothes are too dirty. Insufficient detergent quantity.

Select a proper procedure. Add the proper detergent quantity according to the instructions in detergent package.

Abbnnoorrmmaal lnnooisiese /Gvriberaattivoinbration
Remove the problems

Check if the fixing (bolts) has been removed. CIfhceacbkiinf ethteisfiixninsgta(lbleodltso)nhathsebseoenlidreamnodvleedv.el Iflcoaobr.inet is installed on a solid and level floor.
CChheecckkififthtehreerearaeraenaynmy ebtaarl roebtjteecstsoirnmsideeta. l Cahrteicckleisf tihnesildeeg.s in the washing machine are aCadrhejuesactdkejdiufsltehtveeedll.elegvseiln. the washing machine

Display LED

Description

Reason

Solution

Door lock problem

Door is not closed properly.

Restart after the door is closed.

Please call up service line if there are still troubles.

WWaateterrininjleect ting pprorobblelemmwwhhiile wwaasshhiningg

Tap is not opened or water

flows too slowly.

Inlet Inlet

vpaiplveeisfitltwPe.ir2sit5sedb.loc

ked.

If water is not supplied

Open the tap or wait till the water supply becomes normal. Check inlet valve filter. Straighten the water pipe Check the other taps in the room.

WPlaetaesr eincleatllPulepasseercvaicllesluinpepoifrtthifeprreobalreemsstiplletrsoiustbwleass.hing

Drain problem while washing

OOuutlteletthhoosseeisisblbolcokcekdedo,r otwr isted Wash and straighten outlet hose. Dtwraisintepdu. mDrpains pbulomcpkeisdblocked Wash drain pump filter
Please Pcalelal usep csaelrlvsiucpeploinret ififptrhoebrleemarsepsetrisllistrtoubles.

Please call Pulpeathse scealrlvsicuepplionret fiof rthaellroethiseramnyaottethrse.r problem.

MODEL: SFLW6 | PRODUCT CODE: 10018 | 07/2019

A
T
21

Appendix
Care Label

TThheelalabeblealnadnidcosnisgonnotnhethfaebrfiacbcraicn caassnisht eyolpu ytoouchtooocsehothoesbeetshtewbayessttowlaauyndtoerlayouunrdcelor tyhoesu:r clothes.

Normal wash Gentle wash

Hand wash

40 Warm wash (max 40 )

Do not wash

Bleach Do not bleach

Chlorine bleach may be used
C

Tumble dry. Medium (max 150 )

C
Chlorine bleach not be used

Tumble dry. Low heat (max 110)

Iron Do not iron

Cool iron(max 110 ) Warm iron.medium (max 150)

Dry clean

Dry clean normal cycle with any solvent
A

Tumble dry normal

Do not dry clean

F
Dry clean normal cycle petroleum solvent only

Dry flat

Drip dry
Hang to dry /Line dry

Iron with cloth

Dry after wash Warmly dry clean

Steam Iron

Line Dry in shade Do not tumble dry

Line Dry

No Wring

No machine wash

ELECTRICAL WARNING!

TTooaavovidofiidre,fierleec,terilceacl sthroiccak lasndhootchkeraacncdidoentthse, prleaacsce irdemenemtsb,epr lteheafsoellorweinmg eremmibnederr:the following reminding:

– Only the voltage indicated in power label can be used. If you are not clear of the voltage

–
– –

tOWhnaWehletylonhhtchyeoaeolnmuvpoyoaelwrto,eaeugpureslaceiionnramgdesiptcuheaaestnecyhidn.oeaogntnitntathghceefutphntochewteiaoentrlio,lnatcbhgaeelflmucpaanonxciwmbteiueomurnsbe,cduut.rhrrIeeefnyatmoutuha.raoxrueigmnhoutthmcelewcaarusorhfritnehgnemtvotahlctahrgoineueagwt hihllotrmehaeec,hpw1lea0aAss.ehicnogntact

Thmeraefcohrei,npeleawseillmraekaecshure1t0hAe p. oTwheer rseupfoplryeu,npitsle(causrrenmt, vaoklteagseuarned cthabelep) coawn emreestuthpepnlyormunalitlosad(current,

— rdPearvqPomuotreairlocgettatmeet.gheScenepttpseatochfnwoiaerdel traphccteotoaemwrnbdtaeilopcernrh)oicsnpchoeeao.rrlunydl.dmTpbhreeeoepppaoteiwtdrheltyreo.ctnohPreodorsswmohceoakurelltdcl.ooIbtaersddhfioxsrueehdldqawbuleelilbrlpesleuomgftghiexeandet tiditsnwtwofiollethnrleoltthsstoeoricpkmtehpteaaeoctaphsiletiilynwoareincl.ldanuasotetteantnrtiyiopn the

shpalel boeppleaidotroothteheplrugthlioncgatsiona.nd be damaged. Special attention shall be paid to the socket. It

– Doshnoatllovbeerlopaldutghegewdall-inmtoounttheed ssoocckekteotrsuseeaesxitleynsaionndcaabtltee. nOtvieorlnoasdhinaglol fbtheepwairiidngtmo atyhceaupsleufgireloocr ation. — eToleDceotnrsicnuarolestyhmooucarksk.aDefeotthyn,oetthpweupallolowl- uemtrthpoeluupgnostwheeodruplsdluobgcewkineitshterwoteevdtehirnaltnoodaasnd. eeadrthoerdctahrbeele-peolxetseonckdeet.d. Overloading of the
wiring may cause fire or electrical shock. Do not pull out power plug with wet hand.

C-areTfuollyecnhsecukraenydoeunsrusreatfheattyy,opuroswocekretpislupgrospehralylal nbdereinliasbelyreteardtheind.to an earthed three-pole socket.

Carefully check and ensure that your socket is properly and reliably earthed.

P.27

22

MODEL: SFLW6 | PRODUCT CODE: 10018 | 07/2019

Technical Data
RATING LABEL

ADDITIONAL INFORMATION FOR STANDARD PERFORMANCE TESTING

(AS/NZS 2040.1:2005+Amdt1-2007+Amdt2-2009) 1. Water connections: Cold & hot water connection 2. Water supply pressure: 320 kPa 3. Warm wash Program: Cotton 60º C Display: 4:36
Cold wash program: Cotton Cold (no temperature display is cold wash) 4. Detergent type: Drum detergent 5. Detergent quantity: Default 6. Adding detergent: The detergent is dissolved and added as Paragraph B7.3 of AS/NZS 2040.1 The detergent shall be dissolved in 1 L of water 7. Anti-sudsing agent: Max 8. Test load mass: 6.0kg 9. Water consumption: 61L 10. Test Voltage:220-240V~,50Hz

1. Water connections: Cold & hot water connection 2. Water supply pressure: 320 kPa 3. Warm wash Program: Cotton 60º C Display: 4:41
Cold wash program: Cotton Cold (no temperature display is cold wash) 4. Detergent type: Drum detergent 5. Detergent quantity: Default 6. Adding detergent: The detergent is dissolved and added as Paragraph B7.3 of AS/NZS 2040.1 The detergent shall be dissolved in 1 L of water 7. Anti-sudsing agent: Max 8. Test load mass: 7.5kg 9. Water consumption: 77L 10. Test Voltage:220-240V~,50Hz

MODEL: SFLW6 | PRODUCT CODE: 10018 | 07/2019

23

6kg60Fcrmo/n9t0LcomadCaWnoapsyhRinagngMeahocohdine
Repair and Refurbished Goods or Parts Notice

Unfortunately, from time to time, faulty products are manufactured which need to be returned to the Supplier for repair.
Please be aware that if your product is capable of retaining user-generated data (such as files stored on a computer hard drive, telephone numbers stored on a mobile telephone, songs stored on a portable media player, games saved on a games console or files stored on a USB memory stick) during the process of repair, some or all of your stored data may be lost. We recommend you save this data elsewhere prior to sending the product for repair.
You should also be aware that rather than repairing goods, we may replace them with refurbished goods of the same type or use refurbished parts in the repair process.
Please be assured though, refurbished parts or replacements are only used where they meet ALDI’s stringent quality specifications.
If at any time you feel your repair is being handled unsatisfactorily, you may escalate your complaint. Please telephone us on 1300 11 43 57 or write to us at:
Residentia Group 165 Barkly Avenue, Burnley VIC 3066 Australia

Email: support@residentiagroup.com.au

Helpline hours of operation: Mon­Fri 9:00 AM – 5:00 PM

3

24

MODEL: SFLW6 | PRODUCT CODE: 10018 | 07/2019

MODEL: SFLW6 | PRODUCT CODE: 10018 | 07/2019

25

This page is intentionally left blank

26

MODEL: SFLW6 | PRODUCT CODE: 10018 | 07/2019

This page is intentionally left blank

MODEL: SFLW6 | PRODUCT CODE: 10018 | 07/2019

27

28

MODEL: SFLW6 | PRODUCT CODE: 10018 | 07/2019

References

• Product Registration

Read User Manual Online (PDF format)

Read User Manual Online (PDF format)  >>

Download This Manual (PDF format)

Download this manual  >>