mars VMH09 Series Single Multi Zone Mini Splits User Manual

VMH09 Series Single Multi Zone Mini Splits

Specifications

• Model: VMH09,12, 18, 24 SV Series
• Remote Control Range: 8m

Product Usage Instructions

1. Inserting and Replacing Batteries

Your air conditioning unit may come with two batteries (some
units). Follow the steps below to insert or replace the
batteries:

1. Slide the back cover of the remote control downward to expose
   the battery compartment.

2. Insert the batteries, ensuring that the (+) and (-) ends of the
   batteries match the symbols inside the battery compartment.

3. Slide the battery cover back into place.

Battery Notes:

• If you don’t plan on using the device for more than 2 months,
  remove the batteries.

• Dispose of batteries according to local laws and
  regulations.

2. Buttons and Functions

Before using your air conditioner, familiarize yourself with the
remote control functions:

• ON/OFF: Turns the unit on or off.

• SET: Scrolls through operation functions such
  as Fresh, Sleep, Follow Me, AP mode, etc. Press the OK button to
  confirm the selected function.

• TEMP: Decreases temperature in 1°C (1°F)
  increments. Minimum temperature is 16°C (60°F).

• FAN SPEED: Selects fan speeds in the following
  order: AU 20%, 40%, 60%, 80%, 100%. Use the TEMP or buttons to
  increase or decrease the fan speed in 1% increments.

• SWING: Starts and stops the horizontal louver
  movement. Hold down for 2 seconds to initiate the vertical louver
  auto swing feature.

• MODE: Scrolls through operation modes such as
  AUTO, COOL, DRY, HEAT, FAN. Note that HEAT mode is not supported by
  the cooling-only appliance.

For detailed instructions on how to operate your air
conditioner, refer to the “How to Use Basic Functions” section of
the manual.

FAQ (Frequently Asked Questions)

1. Q: What should I do if the set temperature
   automatically changes when I turn on the unit again?
   A: If the unit is turned off under COOL, AUTO, or DRY mode with the
   set temperature less than 24°C, the set temperature will be
   automatically set to 24°C when you turn on the unit again. If the
   unit is turned off under HEAT mode with the set temperature more
   than 24°C, the set temperature will also be automatically set to
   24°C when you turn on the unit again.

2. Q: What should I do if I’m not sure what a function
   does?
   A: Refer to the “How to Use Basic Functions” and “How to Use
   Advanced Functions” sections of the manual for a detailed
   description of how to use your air conditioner.

3. Q: What should I do if I need more information about
   the product?
   A: For more information, refer to the user manual that came with
   your product. If there are any discrepancies between this manual
   and the user’s manual, the description in the user’s manual shall
   prevail.

REMOTE CONTROL MANUAL
Single-Multi Zone Mini-Splits
Model VMH09,12, 18, 24 SV Series
517.787.2100 · www.marsdelivers.com

Table of Contents

Remote Control Manual – VMHxxSV

Remote Controller Specifications ………………………………………………02 Handling the Remote Controller …………………………………………….03 Buttons and Functions ………………………………………………………….04 Remote Screen Indicators ……………………………………………………..08 How to Use Basic Functions ………………………………………………….09 How to Use Advanced Functions …………………………………………..11

Remote Control Manual – VMHxxSV
Remote Controller Specifications

RG10A(D2S)/BGEF, RG10A(D2S)/BGEFU1,RG10A1(D2S)/BGEF, RG10A2(D2S)/BGEFU1, RG10A2(D2S)/BGCEFU1, RG10A2(D2S)/BGCEF, RG10A10(D2S)/BGEF, RG10B(D2)/BGEF, RG10B1(D2)/BGEF, RG10B2(D2)/BGCEF,RG10B10(D2)/BGEFRG10B10(D2)/BGCEF, RG10Y1(D2)/BGEF,RG10Y2(D2S)/BGEF 3.0V( Dry batteries R03/LR03×2)
8m
-5°C~60°C(23°F~140°F)
NOTE: For models of RG10Y1 (D2)/BGEF,RG10Y2(D2S)/BGEF, If the unit is turned off under COOL, AUTO or DRY mode with the set temperature less than 24 C, the set temperature will be automatically set to 24 C when you turn on the unit again. If the unit is turned off under HEAT mode with the set temperature more than 24 C, the set temperature will be automatically set to 24 C when you turn on the unit again.
Quick Start Guide

1
FIT BATTERIES

2
AUTO COOL DRY HEAT FAN
SELECT MODE

3
SELECT TEMPERATURE

6

5

4

PRESS POWER BUTTON

Swing

My Mode F

Mode

HEDARCTYOAOULTO

SET TEMPERATURE LOMWEHDIGFAHN

On/Off Fan

Sleep

POINT REMOTE TOWARD UNIT

SELECT FAN SPEED

NOT SURE WHAT A FUNCTION DOES? Refer to the How to Use Basic Functions and How to Use Advanced Functions sections of this manual for a detailed description of how to use your air conditioner.

SPECIAL NOTE
· Button designs on your unit may differ slightly from the example shown. · If the indoor unit does not have a particular function, pressing that function’s button on
the remote control will have no effect. · When there are wide differentces between “Remote controller Manual” and “USER’S
MANUAL” on function description, the description of “USER’S MANUAL” shall prevail.

2

Handling the Remote Controller

Remote Control Manual – VMHxxSV

Inserting and Replacing Batteries
Your air conditioning unit may come with two batteries(some units). Put the batteries in the remote control before use. 1. Slide the back cover from the remote control
downward, exposing the battery compartment. 2. Insert the batteries, paying attention to match
up the (+) and (-) ends of the batteries with the symbols inside the battery compartment. 3. Slide the battery cover back into place.
BATTERY NOTES
For optimum product performance: · Do not mix old and new batteries, or
batteries of different types. · Do not leave batteries in the remote control
if you don’t plan on using the device for more than 2 months.
BATTERY DISPOSAL
Do not dispose of batteries as unsorted municipal waste. Refer to local laws for proper disposal of batteries.
TIPS FOR USING REMOTE CONTROL · The remote control must be used within 8
meters of the unit. · The unit will beep when remote signal is
received. · Curtains, other materials and direct sunlight
can interfere with the infrared signal receiver. · Remove batteries if the remote will not be
used more than 2 months.

NOTES FOR USING REMOTE CONTROL
The device could comply with the local national regulations. · In Canada, it should comply with
CAN ICES-3(B)/NMB-3(B). · In USA, this device complies with part 15 of the
FCC Rules. Operation is subject to the following two conditions: (1) This device may not cause harmful interference,
and (2) this device must accept any interference
received, including interference that may cause undesired operation. This equipment has been tested and found to comply with the limits for a Class B digital device, pursuant to part 15 of the FCC Rules. These limits are designed to provide reasonable protection against harmful interference in a residential installation. This equipment generates, uses and can radiate radio frequency energy and, if not installed and used in accordance with the instructions, may cause harmful interference to radio communications. However, there is no guarantee that interference will not occur in a particular installation. If this equipment does cause harmful interference to radio or television reception, which can be determined by turning the equipment off and on, the user is encouraged to try to correct the interference by one or more of the following measures: Reorient or relocate the receiving antenna. Increase the separation between the equipment and receiver. Connect the equipment into an outlet on a circuit different from that to which the receiver is connected. Consult the dealer or an experienced radio/TV technician for help. Changes or modifications not approved by the party responsible for compliance could void user’s authority to operate the equipment.

3

Remote Control Manual – VMHxxSV

Buttons and Functions

Before you begin using your new air conditioner, make sure to familiarize yourself with its remote control. The following is a brief introduction to the remote control itself. For instructions on how to operate your air conditioner, refer to the How to Use Basic Functions section of this manual.

ON/OFF Turns the unit on or off.
TEMP Increases temperate in 1°C (1°F) increments. Max. temperature is
30°C (86°F). NOTE: Press together &
buttons at the same time for 3 seconds will alternate the temperature display between the °C & °F.
SET Scrolls through operation functions as follows: Fresh( ) Sleep( ) Follow Me( ) AP mode( ) Fresh…
The selected symbol will flash on the display area, press the OK button to confirm.
TEMP Decreases temperature in 1OC(1OF) increments. Min. temperature is 16OC(60OF).
FAN SPEED Selects fan speeds in the following order: AU 20% 40%60% 80% 100%.
Press the TEMP or button to increase/decrease the fan speed in 1% increments.
SWING Starts and stops the horizontal louver movement. Hold down for 2 seconds to initiate vertical louver auto swing feature.

MODE Scrolls through operation modes as follows: AUTO COOL DRY HEAT FAN
NOTE: HEAT mode is not supported by the cooling only appliance.
ECO/GEAR Press this button to enter the energy efficient mode in a sequence of following: ECO GEAR(75%) GEAR(50%) Previous setting mode ECO ……
OK Used to confirm the selected functions
TIMER
Set timer to turn unit on or off
BREEZE AWAY This feature avoids direct air flow blowing on the body and makes you feel indulging in silky coolness.
NTOE: This feature is available under cool, Fan and Dry mode only
CLEAN Used to start/stop the Self Clean or Active Clean function. (Model dependent, please refer to the USER’S OPERATION & INSTALLATION MANUAL).
LED Turns indoor unit’s LED display and air conditioner buzzer on and off (model dependent), which create a comfortable and quiet environment.
Turbo Enables unit to reach preset temperature in shortest possible time

Model: RG10A2(D2S)/BGEFU1,RG10Y2(D2S)/BGEF RG10A10(D2S)/BGEF(20-28 OC/68-82O F) RG10A(D2S)/BGEF & RG10A(D2S)/BGEFU1(Fresh feature is not available) RG10A2(D2S)/BGCEFU1 & RG10A2(D2S)/BGCEF (Cooling only models, AUTO mode and HEAT mode are not available)

4

ON/OFF Turns the unit on or off.
TEMP Increases temperate in 1°C (1°F) increments. Max. temperature is 30°C (86°F). NOTE: Press together &
buttons at the same time for 3 seconds will alternate the temperature display between the °C & °F.
SET Scrolls through operation functions as follows: Breeze Away( ) Sleep ( )Follow Me( ) AP mode( ) Breeze Away …
The selected symbol will flash on the display area, press OK button to confirm.
TEMP Decreases temperature in 1OC(1OF) increments. Min. temperature is 16OC(60OF).
FAN SPEED Selects fan speeds in the following order: AU 20% 40%60% 80% 100%. Press the TEMP or button to increase/decrease the fan speed in 1% increments.
SWING
Starts and stops the horizontal louver movement. Hold down for 2 seconds to initiate vertical louver auto swing feature.
Model: RG10A1(D2S)/BGEF

Remote Control Manual – VMHxxSV
MODE Scrolls through operation modes as follows: AUTO COOL DRY HEAT FAN NOTE: HEAT mode is not supported by the cooling only appliance.
ECO/GEAR Press this button to enter the energy efficient mode in a sequence of following: ECO GEAR(75%) GEAR(50%) Previous setting mode ECO ……
OK Used to confirm the selected functions
TIMER Set timer to turn unit on or off
FRESH Used to starts and stops the Fresh feature.
CLEAN Used to start/stop the Self Clean or Active Clean function. (Model dependent, please refer to the USER’S OPERATION & INSTALLATION MANUAL).
LED Turns indoor unit’s LED display and air conditioner buzzer on and off (model dependent), which create a comfortable and quiet environment.
Turbo Enables unit to reach pr temperature in shortest possible time

5

Remote Control Manual – VMHxxSV
ON/OFF Turns the unit on or off.
TEMP Increases temperate in 1°C (1°F) increments. Max. temperature is 30°C (86°F). NOTE: Press together &
buttons at the same time for 3 seconds will alternate the temperature display between the °C & °F.
SET Scrolls through operation functions as follows: Fresh( )Follow Me( ) AP mode( ) Fresh …. The selected symbol will flash on the display area, press the OK button to confirm.
TEMP Decreases temperature in 1OC(1OF) increments. Min. temperature is 16OC(60OF).
FAN SPEED Selects fan speeds in the following order: AUTO LOWMED HIGH
NOTE: Holding this button down for 2 seconds will activate Silence feature.
SWING Starts and stops the horizontal louver movement. Hold down for 2 seconds to initiate vertical louver auto swing feature(some units).

MODE Scrolls through operation modes as follows: AUTO COOL DRY HEAT FAN NOTE: HEAT mode is not supported by the cooling only appliance.
SLEEP Saves energy during sleeping hours.
OK Used to confirm the selected functions
TIMER Set timer to turn unit on or off.
SHORTCUT Used to restore the current settings or resume previous settings.
CLEAN Used to start/stop the Self Clean or Active Clean function. (Model dependent, please refer to the USER’S OPERATION & INSTALLATION MANUAL).
LED Turns indoor unit’s LED display and air conditioner buzzer on and off (model dependent), which create a comfortable and quiet environment.
Turbo Enables unit to reach preset temperature in shortest possible time

Model: RG10B(D2)/BGEF(Fresh feature is not available) RG10B10(D2)/BGEF & RG10B10(D2)/BGCEF(20-28OC/68-82OF) RG10B2(D2)/BGCEF & RG10B10(D2)/BGCEF (Cooling only model, AUTO mode and HEAT mode are not available ) RG10Y1(D2)/BGEF

6

ON/OFF Turns the unit on or off.
TEMP Increases temperate in 1°C (1°F) increments. Max. temperature is 30°C (86°F). NOTE: Press together &
buttons at the same time for 3 seconds will alternate the temperature display between the °C & °F.
SET Scrolls through operation functions as follows: Follow Me( ) AP mode ( ) Follow Me( )…
The selected symbol will flash on the display area, press OK button to confirm.
TEMP Decreases temperature in 1OC(1OF) increments. Min. temperature is 16OC(60OF).
FAN SPEED Selects fan speeds in the following order: AUTO LOWMED HIGH
NOTE: Holding this button down for 2 seconds will activate Silence feature.
SWING Starts and stops the horizontal louver movement. Hold down for 2 seconds to initiate vertical louver auto swing feature(some units).

Remote Control Manual – VMHxxSV
MODE Scrolls through operation modes as follows: AUTO COOL DRY HEAT FAN NOTE: HEAT mode is not supported by the cooling only appliance.
SLEEP Saves energy during sleeping hours. OK Used to confirm the selected functions
TIMER Set timer to turn unit on or off
FRESH Used to start/stop the air fresh feature.
CLEAN Used to start/stop the Self Clean or Active Clean function. (Model dependent, please refer to the USER’S OPERATION & INSTALLATION MANUAL).
LED Turns indoor unit’s LED display and air conditioner buzzer on and off (model dependent), which create a comfortable and quiet environment.
TURBO Enables unit to reach preset temperature in shortest possible time

Model: RG10B1(D2)/BGEF

7

Remote Control Manual – VMHxxSV

Remote Screen Indicators

Information are displayed when the remote controller is power up.

Transmission Indicator
Lights up when remote sends signal to indoor unit

Breeze Away display(some units) Active clean feature display Fresh feature display Sleep mode display Follow me feature display Wireless control feature display(some units)
Low battery detection display(If flashes)
MODE display Displays the current mode, including:

TIMER ON display
TIMER OFF display Silence feature display

ECO display Displays when ECO feature is activated
GEAR display Displays when GEAR feature is activated

FAN SPEED display

Displays selected fan speed:

Silence LOW MED
HIGH

1% 2%-20% 21%-40% 41%-60% 61%-80%
81%-100%

AUTO

This fan speed can not be adjusted in AUTO or DRY mode.

• Note: [ ] Not all the models can display the fan speed values between AU-100%.

Horizontal louver swing display
Vertical louver auto swing display TURBO mode display
Not available for this unit

LOCK display Displays when LOCK feature is activated.
Temperature/Timer/Fan speed display Displays the set temperature by default, or fan speed or timer setting when using TIMER ON/OFF functions.
Temperature range: 16-30oC/60-86 oF/ (20-28oC/68-82oF) (Model dependent)
Timer setting range: 0-24 hours
Fan speed setting range: AU -100% This display is blank when operating in FAN mode.

Note: All indicators shown in the figure are for the purpose of clear presentation. But during the actaul operation, only the relative function signs are shown on the display window.

8

How to Use Basic Functions

Remote Control Manual – VMHxxSV

ATTENTION Before operation, please ensure the unit is plugged in and power is available.

AUTO Mode Select AUTO mode

Set your desired temperature

Turn on the air conditioner

MODE

NOTE: 1. In AUTO mode, the unit will automatically select the COOL, FAN, or HEAT function based on
the set temperature. 2. In AUTO mode, fan speed can not be set.

COOL or HEAT Mode Select COOL/HEAT mode

Set the temperature

Set the fan speed

Turn on the air conditioner

MODE

DRY Mode Select DRY mode
MODE

Set your desired temperature

Turn on the air conditioner

NOTE: In DRY mode, fan speed can not be set since it has already been automatically controlled.

FAN Mode

Select FAN mode

Set the fan speed

Turn on the air conditioner

MODE

NOTE: In FAN mode, you can’t set the temperature. As a result , no temperature displays in remote screen.
9

Remote Control Manual – VMHxxSV
Setting the TIMER
TIMER ON/OFF – Set the amount of time after which the unit will automatically turn on/off.

TIMER ON setting
Press TIMER button to initiate the ON time sequence.
TIMER

Press Temp. up or down button for for multiple times to set the desired time to turn on the unit.
x5

Point remote to unit and wait 1sec, the TIMER ON will be activated.
1sec

TIMER OFF setting
Press TIMER button to initiate the OFF time sequence.
TIMER

ON/OFF

MODE FAN
SLEEP

TEMP

SCHUOTRT TIMER ON

TIMER OFF

Press Temp. up or down button for for multiple times to set the desired time to turn off the unit.
x10

Point remote to unit and wait 1sec, the TIMER OFF will be activated.
1sec

ON/OFF

MODE FAN
SLEEP

TEMP

SCHUOTRT TIMER ON

TIMER OFF

NOTE: 1. When setting the TIMER ON or TIMER OFF, the time will increase by 30 minutes increments with each
press, up to 10 hours. After 10 hours and up to 24, it will increase in 1 hour increments. (For example, press 5 times to get 2.5h, and press 10 times to get 5h,) The timer will revert to 0.0 after 24. 2. Cancel either function by setting its timer to 0.0h.

TIMER ON & OFF setting(example) Keep in mind that the time periods you set for both functions refer to hours after the current time.

xn
TIMER

xn
TIMER

ON/OFF

MODE FAN
SLEEP

TEMP

SCHUOTRT TIMER ON

TIMER OFF

ON/OFF

MODE FAN
SLEEP

TEMP

SCHUOTRT TIMER ON

TIMER OFF

Timer starts

Unit turns
ON

Unit turns
OFF

Current time 1PM

2:00PM 3:00PM

3:30PM

4PM

2.5 hours later 5 hours later

5PM

6PM

Example: If current timer is 1:00PM, to set the timer as above steps, the unit will turn on 2.5h later (3:30PM) and turn off at 6:00PM.

10

How to Use Advanced Functions
Swing function Press Swing button
Swing

Remote Control Manual – VMHxxSV
2s
Swing

The horizontal louver will swing up and down automatically when pressing Swing button. Press again to make it stop.
Airflow direction
Swing

Keep pressing this button more than 2 seconds, the vertical louver swing function is activated. (Model dependent)
If continue to press the SWING button, five different airflow directions can be set. The louver can be move at a certain range each time you press the button. Press the button until the direction you prefer is reached.

NOTE: When the unit is off, press and hold MODE and SWING buttons together for one second, the louver will open for a certain angle, which makes it very convenient for cleaning. Press and hold MODE and SWING buttons together for one second to reset the louver(Model dependent).

LED DISPLAY Press LED button
LED

5s

Press this button more

LED

than 5 seconds(some units)

Press this button to turn on and turn off the display on the indoor unit.

Keep pressing this button more than 5 seconds, the indoor unit will display the actual room temperature. Press more than 5 seconds again will revert back to display the setting temperature.

11

Remote Control Manual – VMHxxSV
ECO/GEAR function
Press this button to enter the energy efficient mode in a sequence of following: ECO GEAR(75%) GEAR(50%) Previous setting mode ECO…… Note:This function is only available under COOL mode.
ECO operation:
Under cooling mode, press this button, the remote controller will adjust the temperature automatically to 24OC/75 OF, fan speed of Auto to save energy (only when the set temperature is less than 24O C/75OF). If the set temperature is above 24OC/75 OF, press the ECO button, the fan speed will change to Auto, the set temperature will remain unchanged. NOTE: Pressing the ECO/GEAR button, or modifying the mode or adjusting the set temperature to less than 24 OC/75OF will stop ECO operation. Under ECO operation, the set tmeperature should be 24OC/75 OF or above, it may result in insufficient cooling. If you feel uncomfortable, just press the ECO button again to stop it.
GEAR operation:
Press the ECO/GEAR button to enter the GEAR operation as following: 75%(up to 75% electrial energy consumption)
50%(up to 50% electrial energy consumption)
Previous setting mode.
Under GEAR operation, the display on the remote controller will alternage between electical energy consumption and set temperature.
SHORTCUT function Press SHORTCUT button(some units)
Push this button when remote controller is on, the system will automatically revert back to the previous settings including operating mode, setting temperature, fan speed level and sleep feature (if activated). If pushing more than 2 seconds, the system will automatically restore the current operation settings including operating mode, setting temperature, fan speed level and sleep feature (if activated ).
12

Silence function

Remote Control Manual – VMHxxSV

2s
Keep pressing Fan button for more than 2 seconds to activate/disable Silence function(some units).
Due to low frequency operation of compressor, it may result in insufficient cooling and heating capacity. Press ON/OFF, Mode, Sleep, Turbo or Clean button while operating will cancel silence function.

FP function
2

The unit will operate at high fan speed (while compressor on) with temperature automatically set to 8 C/46 F.

Note: This function is for heat pump air conditioner only.
Press this button 2 times during one second under HEAT Mode and setting temperature of 16 C/60 F or 20 C/68 F(for models of RG10A10(D2S)/BGEF, RG10B10(D2)/BGEF and RG10B10(D2)/BGCEF) to activate FP function. Press On/Off, Sleep, Mode, Fan and Temp. button while operating will cancel this function.

LOCK function

5s
+ Clean

5s Turbo

Press together Clean button and Turbo button at the same time more than 5 seconds to activate Lock function. All buttons will not response except pressing these two buttons for two seconds again to disable locking.

13

Remote Control Manual – VMHxxSV
SET function

SET

SET or

OK

Press the SET button to enter the function setting, then press SET button or TEMP or TEMP button to select the desired function. The selected symbol will flash on the display area, press the OK button to confirm. To cancel the selected function, just perform the same procedures as above.
Press the SET button to scroll through operation functions as follows:
Breeze Away( ) Fresh( ) Sleep( ) Follow Me( ) AP mode( ) [*]: If your remote controller has Breeze Away button, Fresh button or Sleep button, you can not
use the SET button to select the Breeze Away, Fresh or Sleep feature.

,, ,,

Breeze Away function( ) (some units) : This feature avoids direct air flow blowing on the body and makes you feel indulging in silky coolness. NTOE: This feature is available under cool, Fan and Dry mode only.
FRESH function( ) (some units) : When the FRESH function is initiated, the ion generator is energized and will help to purify the air in the room.
Sleep function( ) : eTnheergSyLEuEsePwfuhnilcetiyoonuisslueseepd(atonddedcorne,atsneeed the same temperature settings to stay comfortable). This function can only be
aFcUotriSvtEahtRee,ddSevMtiaaAilr,NesmUeeoAtLe,.,scleoenptroolp. eration,, in
Note: The SLEEP function is not available in FAN or DRY mode.

Follow me function( ): The FOLLOW ME function enables the remote control to measure the temperature at its current location and send this signal to the air conditioner every 3 minutes interval. When using AUTO, COOL or HEAT modes, measuring ambient temperature from the remote control(instead of from the indoor unit itself) will enable the air conditioner to optimize the temperature around you and ensure maximum comfort.
NOTE: Press and hold Turbo button for seven seconds to start/stop memory feature of Follow Me function.
If the memory feature is activated”, On”
displays for 3 seconds on the screen.
If the memory feature is stopped”, OF”
displays for 3 seconds on the screen. While the memory feature is activated, press the ON/OFF button, shift the mode or power failure will not cancel the Follow me function.
AP function( )(some units) :
Choose AP mode to do wireless network configuration. For some units, it doesn’t work by pressing the SET button. To enter the AP mode, continuously press the LED button seven times in 10 seconds.

14

‘XHWRRQJRLQJSURGXFWLPSURYHPHQWVVSHFLILFDWLRQVDQGGLPHQVLRQVDUH VXEMHFWWRFKDQJHDQGFRUUHFWLRQZLWKRXWQRWLFHRULQFXUULQJREOLJDWLRQV’HWHUPLQLQJWKH
DSSOLFDWLRQDQGVXLWDELOLWIRUXVHRIDQSURGXFWLVWKHUHVSRQVLELOLWRIWKHLQVWDOOHU $GGLWLRQDOOWKHLQVWDOOHULVUHVSRQVLEOHIRUYHULILQJGLPHQVLRQDOGDWDRQWKHDFWXDOSURGXFW
SULRUWREHJLQQLQJDQLQVWDOODWLRQSUHSDUDWLRQV
,QFHQWLYHDQGUHEDWHSURJUDPVKDYHSUHFLVHUHTXLUHPHQWVDVWRSURGXFWSHUIRUPDQFH DQGFHUWLILFDWLRQ$OOSURGXFWVPHHWDSSOLFDEOHUHJXODWLRQVLQHIIHFWRQGDWHRIPDQXIDFWXUH
KRZHYHUFHUWLILFDWLRQVDUHQRWQHFHVVDULOJUDQWHGIRUWKHOLIHRIDSURGXFW 7KHUHIRUHLWLVWKHUHVSRQVLELOLWRIWKHDSSOLFDQWWRGHWHUPLQHZKHWKHUDVSHFLILF
PRGHOTXDOLILHVIRUWKHVHLQFHQWLYHUHEDWHSURJUDPV

:HOOZRUWK$YH-DFNVRQ0,3KZZZKHDWFRQWUROOHUFRP

11/2021

Read User Manual Online (PDF format)

Read User Manual Online (PDF format)  >>

Download This Manual (PDF format)

Download this manual  >>