maras BGE-R01 Series Thru the Wall Owner’s Manual

: June 13, 2024
: maras

BGE-R01 Series Thru the Wall

Product Information – BG/BGE Series

Model: BG-R01 & BGE-R01 Series
Type: Thru-the-Wall Air Conditioner

Safety Precautions

It is important to read and follow the safety precautions to
ensure safe and proper usage of the air conditioner.

Warning: Indicates a hazard with a medium
level of risk which, if not avoided, may result in death or serious
injury.
Caution: Indicates a hazard with a low degree
of risk which, if not avoided, may result in minor or moderate
injury.
Never do this: Indicates operations that are
prohibited and may result in product damage or injury.
Always do this: Indicates operations that can
be performed.

Installation Instructions

Before you get started with the installation, make sure to
review the contents of the box and ensure all components are
present. Follow the step-by-step installation instructions provided
in the manual to properly install your air conditioner.

Operation Instructions

To operate your air conditioner, follow these steps:

Make sure the unit is plugged into a grounding type wall
receptacle.
Check if the power supply cord has a current device. To test
the power supply cord, do the following:
- Plug in the air conditioner.
- Press the TEST button on the plug head. You should hear a click
  as the RESET button pops out.
- Press the RESET button again. You should hear a click as the
  button engages. The power supply cord is now supplying electricity
  to the unit.
Familiarize yourself with the AC’s features and controls.
Set the desired temperature and mode (cooling or heating) using
the control panel.
Ensure the filters are securely inserted before operating the
unit. Clean the filters once every two weeks.

Cleaning & Maintenance

To maintain your air conditioner, follow these guidelines:

Switch off and turn off the circuit breaker before cleaning the
unit to prevent fire and electric shock.
Do not clean the unit when it is powered on.
Clean the filters once every two weeks to ensure proper
functioning.

Troubleshooting

If you encounter any issues with your air conditioner, refer to
the troubleshooting tips provided in the manual. It may help you
resolve common problems without the need for service.

Owner’s Manual – BG/BGE Series
OWNER’S MANUAL
Thru-the-Wall
Model BG-R01 & BGE-R01 Series
517.787.2100 · www1 .marsdelivers.com

CONTENTS
Safety precautions
Installation instructions
What is in the box Before you get started Install your product.
Operation instructions
Get to know your AC. Get to know the features. Cleaning & Maintenance Troubleshooting

Owner’s Manual – BG/BGE Series
03
08 09 12
24 25 29 30

Owner’s Manual – BG/BGE Series
Safety Precautions

Must read the warning message.

Inside you will find many helpful hints on how to use and maintain your air conditioner properly. Just a little preventive care on your part can save you a great deal of time and money over the life of your air conditioner. You’ll find many answers to common problems in the chart of troubleshooting tips. If you review our chart of Troubleshooting Tips first, you may not need to call for service at all.
Explanation of Symbols

To prevent injury to the user or other people and property damage, the following instructions must be followed. Incorrect operation due to ignoring of instructions may cause harm or damage. The seriousness is classified by the following indications.

Warning
The signal word indicates a hazard with a medium level of risk which, if not avoided, may result in death or serious injury.

Caution
The signal word indicates a hazard with a low degree of risk which, if not avoided, may result in minor or moderate injury.

Never do this
This signal indicates the prompt operation is prohibited., if not avoided, may result in Product damaged or injury.

Always do this
This signal means that the operation can be performed.

WARNING
Plug in power plug properly. Otherwise, it may cause electric shock or fire due to excess heat generation. Do not operate or stop the unit by inserting or pulling out the power plug.It may cause electric shock or fire due to heat generation. Do not damage or use an unspecified power cord.It may cause electric shock or fire. If the power cord is damaged, it must be replaced by the manufacturer or an authorised service centre or a similarly qualified person in order to avoid a hazard. Always install circuit breaker and a dedicated power circuit. Incorrect installation may cause fire and electric shock. Do not operate with wet hands or in damp environment. It may cause electric shock . Do not direct airflow at room occupants only. This could damage your health. Always ensure effective grounding.Incorrect grounding may cause electric shock. Do not allow water to run into electric parts.It may cause failure of machine of electric shock. Do not modify power cord length or share the outlet with other appliances. It may cause electric shock or fire due to heat generation.

Owner’s Manual – BG/BGE Series
Unplug the unit if strange sounds, smell, or smoke comes from it. It may cause fire and electric shock. Do not use the socket if it is loose or damaged. It may cause fire and electric shock. Do not open the unit during operation. It may cause electric shock. Keep firearms away. It may cause fire. Do not use the power cord close to heating appliances.It may cause fire and electric shock. Do not use the power cord near flammable gas or combustibles, such as gasoline, benzene, thinner, etc. It may cause an explosion or fire. Ventilate room before operating air conditioner if there is a gas leakage from another appliance. It may cause explosion, fire and, burns. Do not disassemble or modify unit. It may cause failure and electric shock.

CAUTION
When the air filter is to be removed, do not touch the metal parts of the unit. It may cause an injury. Ventilate the room well when used together with a stove, etc. An oxygen shortage may occur. Do not use strong detergent such as wax or thinner but use a soft cloth. Appearance may be deteriorated due to change of product color or scratching of its surface. Do not clean the air conditioner with water. Water may enter the unit and degrade the insulation. It may cause an electric shock. Do not use for special purposes. Do not use this air conditioner to preserve precision devices, food, pets, plants, and art objects.lt may cause deterioration of quality, etc.
4

Stop operation and close the window in storm or hurricane. Operation with windows opened may cause wetting of indoor and soaking of household furniture. When the unit is to be cleaned, switch off, and turn off the circuit breaker. Do not clean unit when power is on as it may cause fire and electric shock, it may cause an injury. Always insert the filters securely. It can be caused failure if operated without filters. Please clean filter once every two weeks.

Owner’s Manual – BG/BGE Series
CAUTION
Hold the plug by the head of the power plug when taking it out. It may cause electric shock and damage. Turn off the main power switch when not using the unit for a long time. It may cause failure of product or fire. Do not place obstacles around air-inlets or inside of air-outlet. It may cause failure of appliance or accident. Do not place heavy object on the power cord and ensure that the cord is not compressed. There is danger of fire or electric shock. Don’t drink water drained from air conditioner. It contains contaminants and could make you sick. Use caution when unpacking and installing. Sharp edges could cause injury. If water enters the unit, turn the unit off at the power outlet and switch off the circuit breaker. Isolate supply by taking the power- plug out and contact a qualified service technician. This appliance is not intended for use by persons(including children) with reduced physical ,sensory or mental capabilities or lack of experience and knowledge,

unless they have been given supervision or instruction concerning use of the appliance by a person responsible for their safety. Children should be supervised to ensure that they do not play with the appliance. If the supply cord is damaged, it must be replaced by the manufacturer, its service agent or similarly qualified persons in order to avoid a hazard. The appliance shall be installed in accordance with national wiring regulations. Installation must be performed in accordance with the requirement of NEC and CEC by authorized personnel only. Do not operate your air conditioner in a wet room such as a bathroom or laundry room. The appliance with electric heater shall have at least 1 meter space to the combustible materials. Contact the authorised service technician for repair or maintenance of this unit. Contact the authorised installer for installation of this unit.

NOTE
This air conditioner is designed to be operated under the following conditions:

Cooling operation
Heating operation

Outdoor temp: Indoor temp:

64-109OF/18-43OC (64-125OF/18-52OC for special tropical models) 62-90OF/ 17-32OC

Outdoor temp:

23-76O

O
F/-5-24 C

Indoor temp:

32-80OF/0-27

O
C

Note:Performance may be reduced outside of these operating temperatures.

Owner’s Manual – BG/BGE Series
Operation of Current Device The power supply cord contains a current device that senses damage to the power cord. To test your power supply cord do the following:
Plug in the Air Conditioner. The power supply cord will have TWO buttons on the plug head. Press the TEST button, you will notice a click as the RESET button pops out. Press the RESET button again, you will notice a click as the button engages. The power supply cord is now supplying electricity to the unit. (On some products this is also indicated by a light on the plug head).

NOTE
The power supply cord with this air conditioner contains a current detection device designed to reduce the risk of fire. In the event that the power cord is damaged, it cannot be repaired it must be replaced with a cord from the product manufacturer. Do not use this device to turn the unit on or off. Always make sure the RESET button is pushed in for correct operation. The power supply cord must be replaced if it fails to reset when either the TEST button is pushed or if it cannot be reset. A new one can be obtained from the product manufacturer.

Grounding type wall receptacle

Do not, under any circumstances, cut,
remove, or bypass the grounding prongs.

Power supply cord with 3-prong grounding plug and current detection device.

Owner’s Manual – BG/BGE Series
WARNING
Electrical Information The complete electical rating of your new room air conditioner is stated on the serial plate. Refer to the rating when checking the electrical requirements.
Be sure the air conditioner is properly grounded. To minimize shock and fire hazards, proper grounding is important. The power cord is equipped with a three-prong grounding plug for protection against shock hazards. Your air conditioner must be used in a properly grounded wall receptacle. If the wall receptacle you intend to use is not adequately grounded or protected by a time delay fuse or circuit breaker, have a qualified electrician install the proper receptacle. Ensure the receptacle is accessible after the unit installation. Do not run air conditioner without side protective cover in place.This could result in mechanical damage within the air conditioner. Do not use an extension cord or an adapter plug.
Avoid fire hazard or electric shock. Do not use an extension cord or an adapter plug. Do not remove any prongs from the power cord.
Electronic Work
WARNING:
BEFORE PERFORMING ANY ELECTRICAL OR WIRING WORK, TURN OFF THE MAIN POWER TO THE SYSTEM.

For Your Safety Do not store or use gasoline or other flammable vapors and liquids in the vicinity of this or any other appliance.
Prevent Accidents To reduce the risk of fire, electrical shock, or injury to persons when using your air conditioner, follow basic precautions, including the following:
Be sure the electrical service is adequate for the model you have chosen. This information can be found on the serial plate, which is located on the side of the the cabinet and behind the grille. If the air conditioner is to be installed in a window,you will probably want to clean both sides of the glass first. If the window is a triple-trackty pew it has creen panel included, remove the screen completely before installation. Be sure the air conditioner has been securely and correctly installed according to the installation instructions in this manual. Save this manual for possible future use in removing or installing this unit. When handling the air conditioner, be careful to avoid cuts from sharp metal fins on front and rear coils.

DISPLAY
MAIN CONTROL

POWER SUPPLY CORD

NOTE: The cographs are for explanation purpose only. Your machine may be slightly different. The actual shape shall prevail.

What is in the Box.

Owner’s Manual – BG/BGE Series
Package content

7 1

14
13
4

2 3
9

17
6 5

1 Air Conditioner Unit

2 Trim Frame (top & bottom legs)*2

3 Trim Frame (side legs)*2

4 Wall Sleeve (purchase separately)

5 Aluminum Grille

6 Plastic Grille (1/8″x4-1/2″x14-1/2″)

Centering/Support Blocks(Blue)*4 (4-1/2″x3-1/2″x1-1/2″)

Tapered Spacer Block(Blue)*2 (7/8″x1-1/8″x17″)

9 Stuffer-seal*1 (1″x1-1/2″x84″)

10 Seal*2 (1″x1-1/2″x14″)

11 Seal*2 (1″x3/4″x14″)

12 Seal*2 (1″x3/8″x14″)

13 Seal*2 (1″x3/8″x25″)

14 Seal*3 (1″x1-1/2″x25″)

15 Plastic Divider*2 (1/8″x4-1/2″x14-1/2″)

16 Screw4 and Screw Washer4

17 Nuts(plastic)*4

18 Ground Wire and Grounding Screw

19 Toothed Washer for Grounding Screw

Prepare the following tools

Gloves

Screwdriver

Pencil

Drill

Ruler or tape measure

Scissors&Knife
Level
*Not Included 8

CAUTION
Do not, under any circumstances, cut or remove the third (ground) prong from the power cord. Do not change the plug on the power cord of the air conditioner. Aluminum house wiring may present special problems- consult a qualified electircian. When handling unit, be careful to avoid cuts from sharp metal edges and aluminum fins on front and rear coils.

Owner’s Manual – BG/BGE Series
Before you get started.

Preparations before installation

Manual

The installation must be carried out

in strict accordance with the instructions

in this manual.

We recommend doing this with a helper.

Installing your AC should take about 60 minutes.
We’re here if you need us, please contact your local distributor for assistance.

NOTE
Save Carton and these Installation Instructions for future reference. The carton is the best way to store unit during winter, or when not in use.

Confirm your installation location requirements and Wall Sleeve Dimensions.

The Air Conditioner dimensions are: 24″ wide, 1 4″ high, and 18″ deep (without front panel). Install Air Conditioner according to these installation instructions to achieve the best performance. Confirm the size of the wall sleeve according to your hole in the wall, identify the wall-sleeve brand for your installation, from the chart below.

Brand

Width

White-Westinghouse

Frigidaire

25-1/2″

Carrier(52F Series)

General Electric/ Hotpoint

26″

Whirlpool

25-7/8″

Fedders/Emerson Sears/Kenmore Carrier(51S Series) Emerson/Fedders Friedrich

27″
25-3/4″ 26-3/4″ 27″

Height
15-1/4″
15-5/8″ 16-1/2″ 16-3/4″ 16-7/8″ 15-3/4″ 16-3/4″

Depth
16″,17-1/2″ or 22″
15-7/8″ 17-1/8″ or 23″ 16-3/4″ or 19-3/4″
18-5/8″
15″ 16-3/4″

According to different wall cover depth, we have divided the installation into 9 categories. Please note that the wall cover of the same brand may also have different depths. Please install according to the depth.

Type #1 #2 #3 #4 #5 #6 #7

8

9

Brand
Emerson
Fedders
Fedders/ Friedrich
General Electric/ Hotpoint Sears/ Carrier(51S Series)
Whirlpool
Whirlpool
White-Westinghouse/ Frigidaire/ Carrier(52F Series)
White-Westinghouse/ Frigidaire

Depth 15″ 19-3/4″ 16-3/4″ 16-7/8″ 18-5/8″ 17-1/8″ 23″
16/17-1/2″
22″

To make the appliance work better, please do not place a barrier in the air outlet, and select the installation location of the product according to the requirements in the following figure.

Over 51cm (20″)

Over 12.2 to 16cm (4-13/16″ to 6-5/16″)

Side View

Over 51cm (20″)

Complete the installation of Wall Sleeve.

Owner’s Manual – BG/BGE Series
Preparations before unit installation

Install the wall sleeve and make grounding connection

Remove old Air Conditioner from wall sleeve and prepare wall sleeve(if any). Clean interior (do not disturb seals). Under the front of the wall cover, there are two 1/8″ holes for ground operation. Use the Ground Wire and Ground Screw(No. 18), and Toothed Washerin(No. 19) the fitting bag for ground installation.

If there is no ground wire installation hole, please drill a 1/8 clearance hole for grounding screw through left side of wall sleeve, in a clear area about 3″ maximum back from front edge of sleeve, using grounding screw and toothed washer. Pull loose end of ground wire out front of sleeve, and temporarily bend it down and around lower edge of sleeve. This ground wire will later be attached to frame of air conditioner once it is installed.

Normal grounding operation

You can choose the left side or the right side for grounding.

1/8″ hole

1″
Unconventional grounding wire operation (hole drilling required)

3″Max

Wall sleeve must be securely fastened in wall before installing Air Conditioner. Drive more nails or screws through sleeve, into wall, if needed(Repair paint if needed).

CAUTION:
All wall sleeves used to mount the new Air Conditioner must be in sound structural condition and have a rear grille that securely attaches to sleeve, or rear flange that serves as a stop for the Air Conditioner. When installation is complete, replacement unit MUST have a rearward slope as shown. Do not use any screws other than those specified here.

Wall Sleeve Rear

Angle3-4°

UNIT

Front

Level

Owner’s Manual – BG/BGE Series
Installation of Aluminum Grill.

Installation of new grill provided with unit

NOTE
We have a new design for the rear grill (two rear air intakes) to improve the performance of the product. Please be sure to use the aluminum grill we provide for installation to achieve the best performance of the product. Most decorative exterior grills may be left in place as long as the proper interior air direction grill is installed.

Outdoor side

Rear grill

Please press the four washers into the hole of the wall sleeve before installing the aluminum grill and tightening the screws.

Wall Sleeve

Rear side

Indoor side
Top View
1

Simple diagram of the rear grill
2

With four washers(No.17)

Confirmation of installation position.

Install Aluminum Grill.
(with Normal Wall Sleeve)

Remove the existing grill. Place the grill included with the new air conditioner towards the rear of the sleeve.

Attach the new grill with self-threading screws and washers.

Simple diagram of the rear grill
3

Drill through the sleeves flanges with a 1/8″drill bit.

Install Aluminum Grill.
(with Unconventional Wall Sleeve)

Mark through the hole positions. Drill through the sleeves flanges with a 1/8″
drill bit. Attach the new grill with self-threading
screws and washers.

Install your product.

9 White Westinghouse or Frigidaire for example

Owner’s Manual – BG/BGE Series
Installation overview
NOTE
Illustrations in this manual are for explanatory purposes. The actual shape of your indoor unit may be slightly different. The actual shape shall prevail.

IMPORTANT Save these instructions for local inspectors use. Observe all governing codes and ordianaces. Proper installation is the responsibility of the installer. Product failure due to improper installation is not covered under the Warranty.

Nine installation methods we will provide, please choose one of the corresponding installation method (follow the instructions on page 7 to determine the type) to finish the installation.

If you have difficulty with mounting the grill to the sleeve, follow the instructions for direct mounting on Page 20.

Owner’s Manual – BG/BGE Series

1 Emerson(15″ Deep)

installation guide

NOTE
Complete the first installation step according to the wall cover installation guide (page 8) and aluminum grid installation guide (page 9) .

Guide to installation before embedding the product into the wall

Cut the Seal(NO.13) to a 14″ high, Attach it vertically to the grille as shown.

Tear the Seal(NO.13) paper from the back, and attach it to the top of the sleeve where it meets the aluminum grille.

Cut the Tapered Spacer Block (NO.8) to a 14″ long, Paste it on the sleeve of the bottom.

Sleeve Front View

Don’t forget to place the plastic grille(NO.6) in the wall sleeve between the unit and the aluminum grille.

Cut the Seal(NO.12) to a 14″ high, Paste on the left and right sides of the sleeve.
Paste the support blocks(NO.7) in the center on both sides of the wall sleeve.
Cut the Seal(NO.14) to a 14″ long, Paste it on the sleeve left and right sides of the bottom edge.

Paste the fixed Seal according to the above figure and instructions.

Complete grounding connection and product embedded wall sleeve.

The Seals and blocks shown above are all backed with glue. You need to tear the paper to paste and fix it When installing. Please be careful when you cutting.

Take out the unconnected end of the ground wire in the wall sleeve, and then embed the unit into the wall sleeve, as shown and then hold on. Use a screwdriver to unscrew the second screw below the unit and tighten the ground wire connection(Make sure that the
13 toothed washer is against the cabinet).

Slide the unit completely to the rear to ensure a good seal, making sure the ground wire does not become tangled.

2 Fedders(19-3/4″ Deep)

Owner’s Manual – BG/BGE Series
installation guide

NOTE
Complete the first installation step according to the wall cover installation guide (page 8) and aluminum grid installation guide (page 9) .

Guide to installation before embedding the product into the wall

Cut the Seal(NO.13) to a 14″ high, Attach it vertically to the grille as shown.
Cut the Seal(NO.14) to a 18″ long, Paste it on the sleeve left and right sides of the bottom edge.

Tear the Seal(NO.13) paper from the back, and attach it to the top of the sleeve where it meets the aluminum grille.

Cut the Seal(NO.12) to a 14″ high, Paste on the left and right sides of the sleeve.

Don’t forget to place the plastic grille(NO.6) in the wall sleeve between the unit and the aluminum grille.

Paste the support blocks(NO.7) in the center on both sides of the wall sleeve.
Cut the Tapered Spacer Block(NO.8), and Paste it on the sleeve of the bottom as shown (This operation is to allow the product to drain properly).

Sleeve Front View

3/4″

17″
Tapered Spacer Block

1″

Protection Cut it

4″

paper backing

Paste the fixed Seal according to the above figure and instructions.

Complete grounding connection and product embedded wall sleeve.

The Seals and blocks shown above are all backed with glue. You need to tear the paper to paste and fix it When installing. Please be careful when you cutting.

Slide the unit completely to the rear to ensure a good seal, making sure the ground wire does not become tangled.

Owner’s Manual – BG/BGE Series

3 Fedders or Friedrich(16-3/4″ Deep)

installation guide

NOTE
Complete the first installation step according to the wall cover installation guide (page 8) and aluminum grid installation guide (page 9) .

Guide to installation before embedding the product into the wall

Cut the Seal(NO.13) to a 14″ high, Attach it vertically to the grille as shown.
Cut the Seal(NO.14) to a 15″ long, Paste it on the sleeve left and right sides of the bottom edge.

Tear the Seal(NO.13) paper from the back, and attach it to the top of the sleeve where it meets the aluminum grille.

Cut the Seal(NO.12) to a 14″ high, Paste on the left and right sides of the sleeve.

Don’t forget to place the plastic grille(NO.6) in the wall sleeve between the unit and the aluminum grille.

Sleeve Front View

3/4″

Cut it 17″
Tapered Spacer Block

1″

Protection paper backing

2″

12-1/2″

2-1/2″

Paste the fixed Seal

Complete grounding connection and

according to the above

product embedded wall sleeve.

figure and instructions.

The Seals and blocks shown above are all backed with glue. You need to tear the paper to paste and fix it When installing. Please be careful when you cutting.

Take out the unconnected end of the ground Slide the unit completely

wire in the wall sleeve, and then embed the to the rear to ensure a

unit into the wall sleeve, as shown and then good seal, making sure

hold on. Use a screwdriver to unscrew the

the ground wire does

second screw below the unit and tighten the not become tangled.

ground wire connection(Make sure that the

toothed washer is against the cabinet).
15

4 General Electra/Hotpoint(16-7/8″ Deep)

Owner’s Manual – BG/BGE Series
installation guide

NOTE
Complete the first installation step according to the wall cover installation guide (page 8) and aluminum grid installation guide (page 9) .

Guide to installation before embedding the product into the wall

Tear the Seal(NO.13) paper from the back, and attach it to the top of the sleeve where it meets the aluminum grille.

Cut the Seal(NO.12) to a 14″ high, Paste on the left and right sides of the sleeve.
Cut the Seal(NO.13) to a 14″ high, Attach it vertically to the grille as shown.

Don’t forget to place the plastic grille(NO.6) in the wall sleeve between the unit and the aluminum grille.

Cut the Tapered Spacer Block(NO.8), and Paste it on the sleeve of the bottom as shown (This operation is to allow the product to drain properly).

1 Sleeve Front View

17″

3/4″

Tapered Spacer Block

Protection 13″
paper backing

1″ 4″Cut it

Paste the fixed Seal according to the above figure and instructions.

Complete grounding connection and product embedded wall sleeve.

The Seals and blocks shown above are all backed with glue. You need to tear the paper to paste and fix it When installing. Please be careful when you cutting.

Take out the unconnected end of the ground Slide the unit completely

wire in the wall sleeve, and then embed the to the rear to ensure a

unit into the wall sleeve, as shown and then good seal, making sure

hold on. Use a screwdriver to unscrew the

the ground wire does

second screw below the unit and tighten the not become tangled.

ground wire connection(Make sure that the

toothed washer is against the cabinet).
16

Owner’s Manual – BG/BGE Series

5 Sears or Carrier 51S Series(18-5/8″ Deep)

installation guide

NOTE
Complete the first installation step according to the wall cover installation guide (page 8) and aluminum grid installation guide (page 9) .

Guide to installation before embedding the product into the wall

Tear the Seal(NO.13) paper from the back, and attach it to the top of the sleeve where it meets the aluminum grille.

Cut the Seal(NO.12) to a 15″ high, Paste on the left and right sides of the sleeve.
Cut the Seal(NO.13) to a 15″ high, Attach it vertically to the grille as shown.

Don’t forget to place the plastic grille(NO.6) in the wall sleeve between the unit and the aluminum grille.

Paste the Tapered Spacer Block(NO.8) on the sleeve of the bottom as shown (This operation is to allow the product to drain properly).

1 Sleeve Front View

Paste the fixed Seal according to the above figure and instructions.
The Seals and blocks shown above are all backed with glue. You need to tear the paper to paste and fix it When installing. Please be careful when you cutting.

Complete grounding connection and product embedded wall sleeve.

Slide the unit completely to the rear to ensure a good seal, making sure the ground wire does not become tangled.

6 Whirlpool(17-1/8″ Deep)

Owner’s Manual – BG/BGE Series
installation guide

NOTE
Complete the first installation step according to the wall cover installation guide (page 8) and aluminum grid installation guide (page 9) .

Guide to installation before embedding the product into the wall

Tear the Seal(NO.13) paper from the back, and attach it to the top of the sleeve where it meets the aluminum grille.

Cut the Seal(NO.12) to a 15″ high, Paste on the left and right sides of the sleeve.
Cut the Seal(NO.13) to a 15″ high, Attach it vertically to the grille as shown.

Don’t forget to place the plastic grille(NO.6) in the wall sleeve between the unit and the aluminum grille.

Cut the Tapered Spacer Block(NO.8), and Paste it on the sleeve of the bottom as shown (This operation is to allow the product to drain properly).

1 Sleeve Front View

3/4″ 4″
Cut it

17″

Tapered Spacer Block

1″

13″ Protection
paper backing

Paste the fixed Seal according to the above figure and instructions.

Complete grounding connection and product embedded wall sleeve.

The Seals and blocks shown above are all backed with glue. You need to tear the paper to paste and fix it When installing. Please be careful when you cutting.

Slide the unit completely to the rear to ensure a good seal, making sure the ground wire does not become tangled.

Owner’s Manual – BG/BGE Series

7 Whirlpool(23″ Deep)

installation guide

NOTE
Complete the first installation step according to the wall cover installation guide (page 8) and aluminum grid installation guide (page 9) .

Guide to installation before embedding the product into the wall

Tear the Seal(NO.13) paper from the back, and attach it to the top of the sleeve where it meets the aluminum grille.

For the sleeve with too much depth, we need to add centering/support blocks(No. 7) and Plastic Divider(No. 15). Please refer to the figure for installation.

16-1/2″

The blocks has card slots into which the plastic divider can be inserted. You may need to trim the length to size.

Don’t forget to place the plastic grille(NO.6) in the wall sleeve between the unit and the aluminum grille.

Cut the Seal(NO.12) to a 15″ high, Paste on the left and right sides of the sleeve.

Cut the Seal(NO.13) to a 15″ high, Attach it vertically to the grille as shown.

Paste the Tapered Spacer

Block(NO.8) on the sleeve of the bottom as shown (This operation is to allow

the product to drain

properly).

Paste the fixed Seal according to the above figure and instructions.

Complete grounding connection and product embedded wall sleeve.

The Seals and blocks shown above are all backed with glue. You need to tear the paper to paste and fix it When installing. Please be careful when you cutting.
NOTEThere are two benefits to adding the rear plastic partition: 1. Effective air inlet and outlet interval between the air inlet and outlet grilles at the rear of the unit to improve the efficiency of air inlet and outlet 2. Play the role of stabilizing unit under product working condition.

Slide the unit completely to the rear to ensure a good seal, making sure the ground wire does not become tangled.

8 White Westinghouse/Frigidaire/ Carrier 52F Series(16/17-1/2″ Deep)

Owner’s Manual – BG/BGE Series
installation guide

NOTE
Complete the first installation step according to the wall cover installation guide (page 8) and aluminum grid installation guide (page 9) .

Guide to installation before embedding the product into the wall

Tear the Seal(NO.13) paper from the back, and attach it to the top of the sleeve where it meets the aluminum grille.
Cut the Seal(NO.13) to a 14″ high, Attach it vertically to the grille as shown.

Don’t forget to place the plastic grille(NO.6) in the wall sleeve between the unit and the aluminum grille.
Cut the Seal(NO.12) to a 14″ high, Paste on the left and right sides of the sleeve.

Sleeve Front View

Cut the Seal(NO.14) to a 14″ long, Paste it on the sleeve left and right sides of the bottom edge.

Paste the fixed Seal according to the above figure and instructions.

Complete grounding connection and product embedded wall sleeve.

The Seals and blocks shown above are all backed with glue. You need to tear the paper to paste and fix it When installing. Please be careful when you cutting.

Take out the unconnected end of the ground Slide the unit completely

wire in the wall sleeve, and then embed the to the rear to ensure a

unit into the wall sleeve, as shown and then good seal, making sure

hold on. Use a screwdriver to unscrew the

the ground wire does

second screw below the unit and tighten the not become tangled.

ground wire connection(Make sure that the

toothed washer is against the cabinet).
20

Owner’s Manual – BG/BGE Series

9 White Westinghouse or Frigidaire(22″ Deep)

installation guide

NOTE
Complete the first installation step according to the wall cover installation guide (page 8) and aluminum grid installation guide (page 9) .

Guide to installation before embedding the product into the wall

Tear the Seal(NO.13) paper from the back, and attach it to the top of the sleeve where it meets the aluminum grille.

For the sleeve with too much depth, we need to add centering/support blocks(No. 7) and Plastic Divider(No. 15). Please refer to the figure for installation.

15-1/4″

The blocks has card slots into which the plastic divider can be inserted. You may need to trim the length to size.

Don’t forget to place the plastic grille(NO.6) in the wall sleeve between the unit and the aluminum grille.

Cut the Seal(NO.12) to a 14″ high, Paste on the left and right sides of the sleeve.

Cut the Seal(NO.13) to a 14″ high, Attach it vertically to the grille as shown.

Paste the Tapered Spacer

Block(NO.8) on the sleeve of the bottom as shown (This operation is to allow

the product to drain

properly).

Paste the fixed Seal according to the above figure and instructions.

2
Complete grounding connection and product embedded wall sleeve.

Slide the unit completely to the rear to ensure a good seal, making sure the ground wire does not become tangled.

You can install the aluminum grill first.

Owner’s Manual – BG/BGE Series
installation guide

NOTE
The previous directions are the preferable way to mount the new Aluminum Grill. The units performance is slightly better and the possibility of drafts is reduced. As a last resort, direct mounting of the grill to the unit can be considered (the installation tutorial follows). The Aluminum Grill must be installed prior to inserting the unit into the sleeve.

1/8 Hole Grill & Flange

Screw(NO.16)

Paste the

Seals(NO.12)

Paste the Seals(NO.12) as shown.

2
Install the unit with the Aluminum Grill and embed it into the Wall Sleeve.

Paste the Seals(NO.12) as shown. It provides a safe distance between the fins and the Aluminum Grill, and acts as a buffer to prevent them from touching.

Line up the Aluminum Grill with the rear hole of the unit as shown, then tighten and secure it using Screws and Screw Washer(NO.16). The protruding side of the aluminum grill fin needs to be mounted outwards.

If the unit has not been pre-drilled, carefully drill four 1/8″ holes through the grill and into the side flange of the unit, then fasten it with Screws(NO.16). Be careful not to drill into the copper heat exchanger coils. Finally, insert the unit into the sleeve.

Owner’s Manual – BG/BGE Series
Finally, do some cosmetic work on your product.

installation guide

Step 2

Step 1

Step 3

Do some cosmetic work.

2
The installation is complete.

Step 1: Assemble the Trim Frame(NO.2) by inserting top and bottom pieces into side pieces(NO.3), and embed it into the unit flush with the front panel.

Step 2: Install the Long Stuffer-seal(NO.9) between the wall-sleeve and the unit. Wrap the foam tightly around the fuselage and carefully cut off any excess using a knife.

Step 3: Slide the frame, seal and unit carefully into the Wall Sleeve for internal fixation, taking care that the grounding wire is also properly placed and not damaged.

Congratulations on the installation, but you’re not done yet. Take a break! And then, get to know your product better.

Get to know your AC.

Owner’s Manual – BG/BGE Series
AC unit overview

Components of the product
Air Direction Status display
and Display Front Intake
Grille
front panel

Adjust the Air Direction
Center handles
Levers Filter handshandle

Rear Condenser Vents

Air directional louvers control air flow direction.Your air conditioner has the 4-way directional system described below.The louvers will allow you to direct the air flow Up or Horizontal, and Left or Right throughout the room as needed.Use the center handles to adjust the air directional louvers side-to- side until the desired Left or Right direction is obtained.Pivot horizontal louvers with your fingertips until the desired Up or Horizontal direction is obtained.There are a total of 4 possible air directional orientations available with this system.
CAUTION: Do not stick your fingers
in the air outlet, it may cause an injury.

Owner’s Manual – BG/BGE Series
Get to know the features.

ELECTRONIC CONTROL OPERATING INSTRUCTIONS

NOTE
Before you begin, thoroughly familiarize yourself with the control panel as shown below and all its functions, then follow the symbol for the functions you desire. The unit can be controlled by the unit control alone or with the remote. This control panel is based on the typical model. Not all the functions describing in this manual are available for all the models.The machine

6 11

Connect

Energy Saver

TEMP/TIMER TEMP/TIMER

Sleep

Check Filter

Follow Me

10 4 5 7

6 11

Connect

Energy Saver

TEMP/TIMER TEMP/TIMER

Sleep

Check Filter

Follow Me

10 4 5 7

Auto

Cool

Dry

Mode

Auto

Low

Fan Med

Heat Fan

Timer

High

Auto

Cool

Dry

Mode

Auto

Low

Fan Med

Timer Fan

High

(Electric Heating Models)

(Cooling Only Models)

1. TO TURN UNIT ON OR OFF:
NOTE: The unit will initiate automatically the Energy Saver function under Cool, Dry, Auto(only Auto-Cooling and Auto-Fan) modes.
2. TO CHANGE TEMPERATURE SETTING:

3. TO ADJUST FAN SPEEDS:
Press to select the Fan Speed in four steps-Auto, Low, Med or High. Each time the button is pressed, the fan speed mode is shifted. For some models, the fan speed can not be adjusted under HEAT mode. On Dry mode, the fan speed is controlled at Low automatically

This new temperature will be maintained for 7 hours before it returns to the originally selected temperature. This ends the Sleep mode and the unit will continue to operate as originally programmed. The Sleep mode program can be cancelled at any time during operation by pressing the Sleep button again.

Press / UP/DOWN buttonto change temperature setting. NOTE: Press or hold either UP or DOWN button until the desired temperature is seen on the display. This temperature will be automatically maintained anywhere between 62 F(17 C) and 86 F(30 C). If you want the display to read the actual room temperature, see To Operate on Fan Only section.

4. SLEEP FEATURE:
Press Sleep button to initiate the sleep mode. In this mode the selected temperature will increase (cooling) or decrease (heating) by 2 F/1 C 30 minutes after the mode is selected. The temperature will then increase (cooling) or decrease(heating) by an other 2 F/1 C after an additional 30 minutes.
25

5. CHECK FILTER FEATURE:
Press Check filter button to initiate the feature. This feature is a reminder to clean
The LED(light) will illuminate after 250 hours of operation. To reset after cleaning the filter, press the Check Filter button and

Owner’s Manual – BG/BGE Series
ELECTRONIC CONTROL OPERATING INSTRUCTIONS

6. ENERGY SAVER FEATURE:

8. TO SELECT THE OPERATING MODE:

Press Energy saver button to initiate this function. This function is available on COOL, DRY, AUTO (only AUTO-COOLING and AUTO-FAN) modes.The fan will continue to run for 3 minutes after the compressor shuts off. The fan then cycles on for 2 minutes at 10 minutes intervals until the room temperature is above the set temperature, at which time the compressor turns back on and Cooling Starts.
7. FOLLOW ME FEATURE:
This feature can be activated from the remote control ONLY. The remote control serves as a remote thermostat allowing for the precise temperature control at its location. To activate the Follow Me feature, point the remote control towards the unit and press the Follow Me button. The remote display is actual temperature at its location. The remote control will send this signal to the air conditioner every 3 minutes interval until press the Follow Me button again. If the unit does not receive the Follow Me signal during any 7 minutes interval, the unit will beep to indicate the Follow Me mode has ended.

To choose operating mode, press Mode button. Each time you press the button, a mode is selected in a sequence that goes from Auto, Cool, Dry, heat(cooling only models without) and Fan. The indicator light beside will be illuminated and remained on once the mode is selected. The unit will initiate automatically the Energy Saver function under Cool, Dry, Auto(only Auto- Cooling and Auto-Fan) modes. To operate on Auto feature:
When you set the air conditioner in AUTO mode, itwill automatically select cooling, heating (cooling only models without), or fan only operation depending on what temperature you have selected and the room temperature. The air conditioner will control room temperature automatically round the temperature point set by you. The air conditioner will control room temperature automatically round the temperature point set by you. In this mode, the fan speed cannot be adjusted, it starts automatically at a speed according to the room temperature.

To operate on COOL mode: Choose Cool Mode to set the cooling function. Use the Up and Down buttons to choose the desired temperature. When Cool Mode is selected, the fan speed can be adjusted by pressing the fan button.
To operate on HEAT mode (cooling only models are excluded) :
Choose Heat mode to start heating operation. Use Up and Down buttons to set the desired temperature. Press the fan button to select the fan speed. For some models, the fan speed can’t be adjusted. To operate on Fan Only: Use this function only when cooling is not desired, such as for room air circulation or to exhaust stale air(optional)-Remember to open the vent during this function, but keep it closed during cooling for maximum cooling efficiency. You can choose any fan speed you prefer. During this function, the display will show the actual room temperature, not the set temperature as in the cooling mode. In Fan only mode, the temperature is not adjusted. To operate on Dry mode: In this mode, the air conditioner will generally operate in the form of a dehumidifier. Since the conditioned space is a closed or sealed area, some degree of cooling will continue.

Owner’s Manual – BG/BGE Series
ELECTRONIC CONTROL OPERATING INSTRUCTIONS

9. TIMER: AUTO START/STOP FEATURE:
the TIMER ON indicator light illuminates. It indicates the Auto Start program is initiated. When the time of TIMER ON is displayed, press the Timer button again, the TIMER OFF indicator light illuminates. It indicates the Auto Stop program is initiated. Press or hold the UP or DOWN button to change the Auto time by 0.5 hour increments, up to 10 hours, then at 1 hour increments up to 24 hours.The control will count down the time remaining until start. The selected time will register in 5 seconds, and the system will automatically revert back to display the previous temperature setting or room temperature display). Turning the unit ON or OFF at any time or adjusting Turning the unit ON or OFF at any time or adjusting the timer setting to 0.0 will cancel the Auto Start/Stop timed program.

10. DISPLAY:

Displays
Shows the set temperature in “°C” or “°F ” and the Auto-timer settings. While on Fan only mode, it shows the room temperature. If the room temperature is too high or low, it will display”HI” or “LO”.

Error codes: AS-Room temperature sensor error-Unplug the unit and plug it back in. If error repeats, call for service.
ES-Evaporator temperature sensor
error-Unplug the unit and plug it back in. If error repeats, call for service.
HS-Electric heating sensor error-
Unplug the unit and plug it back in. If error repeats, call for service.
CS-The sensor of the outdoor unit condenser is faulty-Unplug the unit
and plug it back in. If error repeats,
call for service.
oS-Room temperature sensor error-
Unplug the unit and plug it back in. If error repeats, call for service.
E3 The fan stall error-Unplug the unit and plug it back in. If error repeats,
call for service.
E0 Failure of EEPROM parameter-
Unplug the unit and plug it back in. If error repeats, call for service.

11. WIRELESS FUNCTION : Perss the Connect button for 3 seconds to available the wireless connection.

One more thing

Owner’s Manual – BG/BGE Series
Additional Notes

1
Your AC may look a little different.
All the illustrations in this manual are for explanation purpose only. Your air conditioner may be slightly different. The actual shape shall prevail.

2
Additional things you should know.
Now that you have mastered the operating procedure, here are more features in your control that you should become familiar with.
The Cool circuit has an automatic 3 minutes time delayed start if the unit is turned off and on quickly. This prevents overheating of the compressor and possible circuit breaker tripping.The fan will continue to run during this time. The control is capable of displaying temperature in degrees Fahrenheit or degrees Celsius. To convert from one to the other, press and hold the Left and Right Temp/Timer buttons at the same time, for 3 seconds.
28

3
Normal Sounds / Sound Performance
High Pitched Chatter High efficiency compressors may have a high pitched chatter during the cooling cycle.
Sound of Rushing Air At the front of the unit, you may hear the sound of rushing air being moved by the fan.
Gurgle/Hiss “Gurgling or hissing” noise may be heard due to refrigerant passing through evaporator during normal operation.
Vibration Unit may vibrate and make noise because of poor wall or window construction or incorrect installation.
Pinging or Switching Droplets of water hitting condenser during normal operation may cause “pinging or switching” sounds.

Owner’s Manual – BG/BGE Series
Cleaning & Maintenance

How to clean & change your filter.

Check the air filter at least once a month to see if cleaning is necessary.

Air Filter Cleaning
The air filter should be checked at least once a month to see if cleaning is necessary. Trapped particles in the filter can build up and cause an accumulation of frost on the cooling coils. · Take the filter by the center and pull
up and out. · Wash the filter using liquid
dishwashing detergent and warm water. Rinse filter thoroughly. Gently shake excess water from the filter. Be sure the filter is thoroughly dry before replacing. Or, instead of washing you may vacuum the filter clean. Note: Never use hot water over 40°C(104°F) to clean the air filter. Never attempt to operate the unit without the air filter.

Energy Saving Note
In order to reach the maximum energy saving and comfort, it is recommended to use a cover to insulate the unit when the unit is not in use. The recommended size for the unit is 24.4″x14.8″x2.2″(WxHxD).
Cabinet Cleaning
· Be sure to unplug the air conditioner to prevent shock or fire hazard. The cabinet and front may be dusted with an oil-free cloth or washed with a cloth dampened in a solution of warm water and mild liquid dishwashing detergent. Rinse thoroughly and wipe dry.
· Never use harsh cleaners, wax or polish on the cabinet front.
· Be sure to wring excess water from the cloth before wiping around the controls. Excess water in or around the controls may cause damage to the air conditioner.
· Plug in air conditioner.

CAUTION: Clean your air conditioner occasionally
to keep it looking new. Be sure to unplug the unit before cleaning to prevent shock or fire hazards.

CAUTION: If you plan to store the air conditioner during the winter,
remove it carefully from the window according to the installation instructions. Cover it with plastic or return it to the original carton.

TROUBLESHOOTING

Owner’s Manual – BG/BGE Series
Problem Solving

Before calling for service, review this list. It may save your time and expense. This list includes common occurrences that are not the result of defective workman-ship or materials in this appliance.

Problem
Air conditioner does not start.
Air from unit does not feel cold enough.
Air conditioner cooling, but room is too warm- ice forming on cooling coil behind decorative front.

Solution Wall plug disconnected. Push plug firmly into wall outlet. House fuse blown or circuit breaker tripped. Replace fuse with time delay type or reset circuit breaker.
Plug Current Device Tripped. Press the RESET button. Power is OFF. Turn power ON. Room temperature below 62°F(17°C). Cooling may not occur until room temperature rises above 62°F(17°C). Temperature sensing behind air filter element touching cold coil. Keep it from the cold coil. Set to a Lower temperature. Compressor stopped when changing modes. Wait for 3 minutes after set to the COOL mode. Outdoor temperature below 64°F(18°C). To defrost the coil, set FAN ONLY mode. Air filter may be dirty. Clean filter. Refer to Care and Cleaning section. To defrost, set to FAN ONLY mode.
Thermostat set too cold for night-time cooling. To defrost the coil, set to FAN ONLY mode. Then, set temperature to a Higher setting.

Air conditioner turns on and off rapidly

Dirty air filter- air restricted. Clean air filter. Outside temperature extremely hot. Set FAN speed to a Higher setting to bring air past cooling coils more frequently.

Owner’s Manual – BG/BGE Series

Problem Solving

Problem

Solution Dirty air filter- air restricted. Clean air filter. Refer to Care and Cleaning section.

Air conditioner cooling, but room is too warm- NO ice forming on cooling coil behind decorative front.

Temperature is set too High, set temperature to a Lower setting. Air directional louvers positioned improperly. Position louvers for better air distribution. Front of units is blocked by drapes, blinds, furniture, etc. – restricts air distribution. Clear blockage in front of unit. Doors, windows, registers, etc. Open- cold air escapes. Close doors, windows, registers.

Unit recently turned on in hot room. Allow additional time to remove Stored heat from walls, ceiling, floor and furniture.

Noise when unit is cooling
Water dripping OUTSIDE when unit is cooling.
Water dripping OUTSIDE when unit is cooling.

Air movement sound. This is normal . If too loud, set to a slower FAN setting. Window vibration – poor installation. Refer to installation instructions or check with installer. Improper installation. Tilt air conditioner slightly to the outside to allow water drainage. Refer to installation instructions – check with installer.
Unit removing large quantity of moisture from humid room. This is normal during excessively humid days.

Remote Sensing Deactivating Prematurely (Only remote models)

Remote control not located within range. Place remote control within 20 feet and pointed in the general direction of the air conditioner unit.
Remote control signal obstructed. Remove obstruction.

Room too cold

Set temperature too low. Increase set temperatur.

The design and specifications are subject to change without prior notice for product improvement. Consult with the sales agency or manufacturer for details. Any updates to the manual will be uploaded to the service website, please check for the latest version.
31

LIMITED EXPRESS WARRANTY
Congratulations on purchasing your new HVAC equipment. It’s been designed for long life and reliable service, and is backed by one of the strongest warranties in the industry. Your unit automatically qualifies for the warranty coverage listed below, providing you keep your proof of purchase (receipt) for the equipment and meet the warranty conditions.
LIMITED ONE (1) YEAR EXPRESS WARRANTY Comfort-Aire warrants this Room Air Conditioner to be free from defects in workmanship and materials for normal use and maintenance for one (1) year from the date of purchase by the original consumer. This Express Limited Warranty applies only when the Room Air Conditioner is installed and operated per Comfort-Aire installation and operating instructions for normal use.
EXCEPTIONS The Limited Express Warranty does not cover normal maintenance Comfort-Aire recommends that regular inspection/maintenance be performed at least once a season. Additionally, labor charges diagnostic charges, transportation charges for replacement of refrigerant or filters, and any other service calls/repairs are not covered by this Limited Warranty. It also does not cover any portion or component of the system that is not supplied by Comfort-Aire, regardless of the cause of failure of such portion or component.
CONDITIONS FOR WARRANTY COVERAGE
Unit must be operated according to Comfort-Aire operating instructions included with the unit and cannot have been subjected to accident, alteration, improper repair, neglect or misuse, or an act of God (such as a flood) · Serial numbers and/or rating plate have not been altered or removed · Performance cannot be impaired by use of any product not authorized by Comfort-Aire, or by any adjustments or adaptations to components · Damage has not been a result of inadequate wiring or voltage conditions, use during brown-out conditions, or circuit interruptions · Air flow around any section of the unit has not been restricted · Unit remains in the original installation

LIMITATION OF LIABILITY 1. There are no other express or implied warranties. Comfort-Aire makes no
warranty of merchantability. We do not warrant that the unit is suitable for any particular purpose or can be used in buildings or rooms of any particular size or condition except as specifically provided in this document. There are no other warranties, express or implied, which extend beyond the description in this document. 2. All warranties implied by law are limited in duration to the one-term of the warranty. We will not be liable for any consequential or incidental damages caused by any defect in this unit.
3. This warranty gives you specific legal rights and you may also have other rights which vary from state to state. Some states do not allow limitation on how long an implied warranty lasts or do not allow the exclusion or limitation of incidental or consequential damages, so the above limitations or exclusions may not apply to you.
4. No warranties are made for units sold outside the continental United States and Canada. Your distributor or final seller may provide a warranty on units sold outside these areas.
5. Comfort-Aire will not be liable for damages if our performance regarding warranty resolution is delayed by events beyond our control including accident, alteration, abuse, war, government restrictions, strikes, fire, flood, or other acts of God.
HOW TO SUBMIT A WARRANTY CLAIM If you have a warranty claim, notify you installer or dealer promptly.
Please visit www.marsdelivers.com to register your new product

DURATION OF WARRANTY & REGISTRATION The warranty begins on the date of purchase by the original consumer. The consumer must retain a receipted bill of sale as proof of warranty period. Without this proof, the express warranty begins on the date of shipment from the factory.
REMEDY PROVIDED BY THE LIMITED EXPRESS WARRANTY The sole remedy under the Limited Warranty is replacement of the defective unit. Labor to diagnose and replace the defective unit is not covered by this Limited Express Warranty. If for any reason the replacement product is no longer available during the warranty period, Comfort-Aire shall have the right to allow a credit in the amount of the current suggested retail price of the product instead of providing replacement.

KEEP THIS INFORMATION AS A RECORD OF YOUR PURCHASE

PRODUCT IDENTIFICATION

INSTALLATION

Model Number Serial Number Date of Purchase

Installer Name (if used) Phone Number/Contact Information Date Installation Completed

Remember to retain your bill of sale as proof of warranty period.

Owner’s Manual – BG/BGE Series

4/2023

‘XHWRRQJRLQJSURGXFWLPSURYHPHQWVVSHFLILFDWLRQVDQGGLPHQVLRQVDUH VXEMHFWWRFKDQJHDQGFRUUHFWLRQZLWKRXWQRWLFHRULQFXUULQJREOLJDWLRQV’HWHUPLQLQJWKH
DSSOLFDWLRQDQGVXLWDELOLWIRUXVHRIDQSURGXFWLVWKHUHVSRQVLELOLWRIWKHLQVWDOOHU $GGLWLRQDOOWKHLQVWDOOHULVUHVSRQVLEOHIRUYHULILQJGLPHQVLRQDOGDWDRQWKHDFWXDOSURGXFW
SULRUWREHJLQQLQJDQLQVWDOODWLRQSUHSDUDWLRQV
,QFHQWLYHDQGUHEDWHSURJUDPVKDYHSUHFLVHUHTXLUHPHQWVDVWRSURGXFWSHUIRUPDQFH DQGFHUWLILFDWLRQ$OOSURGXFWVPHHWDSSOLFDEOHUHJXODWLRQVLQHIIHFWRQGDWHRIPDQXIDFWXUH
KRZHYHUFHUWLILFDWLRQVDUHQRWQHFHVVDULOJUDQWHGIRUWKHOLIHRIDSURGXFW 7KHUHIRUHLWLVWKHUHVSRQVLELOLWRIWKHDSSOLFDQWWRGHWHUPLQHZKHWKHUDVSHFLILF
PRGHOTXDOLILHVIRUWKHVHLQFHQWLYHUHEDWHSURJUDPV

:HOOZRUWK$YH-DFNVRQ0,3KZZZKHDWFRQWUROOHUFRP

Read User Manual Online (PDF format)

Read User Manual Online (PDF format) >>

Download This Manual (PDF format)

Download this manual >>

BGE-R01 Series Thru the Wall

Product Information – BG/BGE Series

Safety Precautions

Installation Instructions

Operation Instructions

Cleaning & Maintenance

Troubleshooting

8

9

9 White Westinghouse or Frigidaire for example

1 Emerson(15″ Deep)

2 Fedders(19-3/4″ Deep)

3 Fedders or Friedrich(16-3/4″ Deep)

4 General Electra/Hotpoint(16-7/8″ Deep)

5 Sears or Carrier 51S Series(18-5/8″ Deep)

6 Whirlpool(17-1/8″ Deep)

7 Whirlpool(23″ Deep)

8 White Westinghouse/Frigidaire/ Carrier 52F Series(16/17-1/2″ Deep)

9 White Westinghouse or Frigidaire(22″ Deep)

Read User Manual Online (PDF format)

Download This Manual (PDF format)

Related Manuals