esatto EDWI605S 60cm Integrated Dishwasher User Manual

EDWI605S 60cm Integrated Dishwasher

Product Information

Model/s: EDWI605S

Version: V2.0 0123

Brand: Esatto

Distributor: Residentia Group Pty Ltd

Address: Head Office 165 Barkly Avenue Burnley, Victoria
Australia 3121

Contact Information:

• Online: www.esatto.house
• Email: @esatto.house
• Postage: PO Box 5177 Burnley, Victoria Australia 3121
• Telephone: 1300 11 4357

Product Usage Instructions

Safety Instructions

Before using the dishwasher, please read the safety instructions
carefully:

• Do not touch the heating element during or immediately after
  use.

• Do not abuse, sit or stand on the door or dish racks of the
  dishwasher.

• Do not operate the dishwasher unless all enclosure panels are
  properly in place.

• Do not tamper with controls.

• Do not repair or replace any part of the appliance or attempt
  any servicing unless specifically recommended in the user
  manual.

• Carefully follow the installation instructions to avoid any
  damage to the dishwasher or surrounding area.

• Ensure that children do not play with the dishwasher or its
  controls.

• Do not operate the dishwasher unless all filters are properly
  in place and correctly fitted.

• When cleaning the dishwasher, use a dry cloth and do not use
  abrasive or corrosive cleaners.

• Sharp utensils such as knives must be loaded in the basket with
  their points facing down or placed in a horizontal position to
  avoid injury.

• Dispose of packaging materials in a way that will not cause
  damage to the environment and keep them out of reach of
  children.

Quick Start Guide

Before using the dishwasher, make sure it is properly installed
and all filters are correctly fitted. To start using the
dishwasher:

1. Load the dishwasher with dishes, cutlery, cups, and other items
   you want to wash.

2. Add detergent and rinse aid to their respective compartments in
   the dispenser.

3. Select the desired wash program using the control panel.

4. Press the start button to begin the wash cycle.

Control Panel

The control panel allows you to select the desired wash program
and adjust settings. The available programs and settings may vary
depending on the model. Refer to the user manual for detailed
information on the control panel.

Preparing & Loading Dishes

Before loading the dishwasher:

• Remove any food scraps or debris from the dishes.

• Scrape off any burnt-on food or grease with a soft brush or
  cloth.

• Soak heavily soiled dishes in water before loading them into
  the dishwasher.

To load the dishwasher:

1. Place cups and glasses upside down on the top rack.

2. Place plates, bowls, and larger items on the bottom rack.

3. Load cutlery in the cutlery basket with their points facing
   down or placed horizontally.

4. Ensure that dishes do not touch each other or block the spray
   arms.

Rinse Aid & Detergent

Add rinse aid and detergent to their respective compartments in
the dispenser before starting the wash cycle. Refer to the user
manual for information on the recommended types and amounts of
rinse aid and detergent to use.

Cleaning & Maintenance

Regular cleaning and maintenance of the dishwasher can help
prolong its lifespan and ensure optimal performance. Refer to the
user manual for detailed instructions on cleaning and
maintenance.

Troubleshooting

If you experience any issues with the dishwasher, refer to the
troubleshooting section of the user manual for possible solutions.
If the issue persists, contact the support team for assistance.

Model/s EDWI605S

Version V2.0 0123

Everything you need for your 60cm Integrated Dishwasher is in this User Manual

User Manual

2

Welcome

Residentia Group — Head Office 165 Barkly Avenue Burnley, Victoria Australia 3121 — ACN 600 546 656 — Online residentia.group www.esatto.house
@esatto.house — Postage PO Box 5177 Burnley, Victoria Australia 3121 — Telephone 1300 11 4357

Congratulations on purchasing your new Dishwasher. The Esatto brand is proudly distributed within Australia by Residentia Group Pty Ltd.
Please refer to the warranty card at the rear of this manual for information regarding your product’s parts and labour warranty, or visit us online at: www.residentia.group
At Residentia Group, we are customer obsessed and our Support Team are there to ensure you get the most out of your appliance. Should you want to learn more about your new dishwasher, it’s features or importantly taking care of the appliance, our Support Team are here to help.
You can use our online Support Centre at anytime by visiting: http://support.residentiagroup.com.au
Or you can contact us via phone by dialing: 1300 11 HELP (4357).
It is important that you read through the following use and care manual thoroughly to familiarise yourself with the installation and operation requirements of your appliance to ensure optimum performance.
Again, thank you for choosing an Esatto appliance and we look forward to being of service to you.
Kind Regards, The Residentia Team

www.esatto.house

3

esatto.house

Contents

Page 2 Welcome

Page 4 Safety Instructions

Page 5 Your Dishwasher

Page 6 Quick Start Guide

Page 7 Control Panel

Page 8 Installation Instructions

Page 14 Operation Instructions

Page 16 Preparing & Loading Dishes

Page 17 Loading Recommendations

Page 18 Basket Tips

Page 19 Rinse Aid & Detergent

Page 21 Cleaning & Maintenance

Page 23 Troubleshooting

Page 26 Technical Information

Page 27 Purchase Details

Page 28 Warranty

User Manual

4

Safety Instructions

Warning! When using your dishwasher , follow the precautions listed below: · Installation and repair can only be carried out by a
qualified technician. · This appliance is only intended for use indoors
only within a domestic environment. · This appliance is not intended for use by persons
(including children) with reduced physical, sensory or mental capabilities, or lack of experience and knowledge, unless they have been given supervision or instruction concerning use of the appliance by a person responsible for their safety. · Children should be supervised to ensure that they do not play with the appliance. · If the power cord is in any way damaged it must mkneonwbotalreel dcaagrpeea,qbupinulillteaaiessscl,itohefriedeylahcdbkavoyaefbnetexhdepneerglieiimvcneceneansaunnspdueerfvdiasiocentloeur cretrri,ciitasns.ervice agent ·instrTucotiopn rcoontceerncintgausge aofitnhesatptphliaencerbisy ka of electrical shock, pPaecrskdoangoirnegnspmooanttseibirimlael fcmoorutlehderbirsesedaafenttghy.eer(oFouursIfnEoCri6tc0,h3ilc3d5roe-n1r!d) or plug in water Thisoaprploiatncheeisrfolriiqnduoiodr household use only. ·To pProlteecat asgeainustnthpe lriuskgofbeleecftroicarleshcoclke, daonniont g and performing iPmlemamseersuaentiphnleutguenbinet,faocornerdccloeerapnoliunggniantnwdhapeteerrafooprrmoptinhlgeiraliqnucide. . ·mainUtesneancae osnothfet acpploliatnhce.moistened with mild soap, and Usetahsoeftnclouthsemoaistednerdywcithlomtilhd stooap,wanidptehenit again.
use a dry cloth to wipe it again.
EEaArthRiTngHIInNstGrucItNionSsTRUCTIONS · ThiTs ahpipsliaancpe mpulsitabne ecaerthmed.uInstthebeveenet oaf rathed. In the event of a
mamlfunacltifoun norcbtreiaokdnowonr, ebarrtheinagkwdillorewducne,theearthing will reduce rriessktishotafenacnereiolsefcketlreicoctsrfhicoaccuknrrbeyenptl.reoTvhciidstinarpgipcaliapsnahctheoiosfclekasbt y providing a path of equleipapesdtwriteh asniseatrathnincg ceonodufcteorleplcugt.ric current. This appliance Theispluegqmuuispt bpe epludggwediitnhto aannapepraoprritahteing conductor plug. · owuitTthlehat ltlehloactpaillsuciongdsteasmllaendudasnodrtdeibnaaretnhceepds.linuagccgoredadnciento an appropriate Imporouptelrecotnntehctaiotn iosf thine esqtuaiplmleendt- eaarnthdingearthed in accordance conwduictthor caanllrelsouclt ian lthce orisdk oefsanaenlecdtricoshrodckin. ances. · CrehpIermecksepwntirtahotivapeqieuf ayrloifucieadoreenliennctderoiccuiabtntioworhnseetrhoveicrfethtehe equipment- earthing appclioanncedisupcrotpoerrly cgraounndrede.sult in the risk of an electric
shock. 4 · Check with a qualified electrician or service
representative if you are in doubt whether the appliance is properly grounded. · Do not modify the plug provided with the appliance; If it does not fit the outlet. · Have a proper outlet installed by a qualified electrician. · Do not abuse, sit on, or stand on the door or dish rack of the dishwasher. · Do not operate your dishwasher unless all enclosure panels are properly in place. · Open the door very carefully if the dishwasher is operating, there is a risk of water squirting out. · Do not place any heavy objects on or stand on the door when it is open. The appliance could tip forward. · When loading items to be washed: 1) Locate sharp items so that they are not likely
to damage the door seal; 2) Warning: Knives and other utensils with
sharp points must be loaded in the basket with their points facing down or placed in a horizontal position.

· Some dishwasher detergents are strongly alkaline. They can be extremely dangerous if swallowed. Avoid contact with the skin and eyes and keep children away from the dishwasher when the door is open.
· Check that the detergent powder is empty after completion of the wash cycle.
· Do not wash plastic items unless they are marked “dishwasher safe” or the equivalent.
· For unmarked plastic items not so marked, check the manufacturer’s recommendations.
· Use only detergent and rinse agents recommended for use in an automatic dishwasher.
· Never use soap, laundry detergent, or hand washing detergent in your dishwasher.
· The door should not be left open, since this could increase the risk of tripping.
· If the supply cord is damaged, it must be replaced by the manufacturer or its service agent or a similarly qualified person in order to avoid a hazard.
· During installation, the power supply must not be excessively or dangerously bent or flattened.
· Do not tamper with controls. · The appliance needs to be connected to the main
water valve using new hose sets. Old sets should not be reused. · To save energy, in stand by mode , the appliance will switch off automatically while there is no any operation in 30 minutes .
UNPACKING · After unpacking, please dispose of all elements of
packaging in a way that will not cause damage to the environment. Caution! During unpacking, the packaging
materials (polythene bags, polystyrene pieces, etc.) should be Disposkaelpt out of reach of children.
DISPOSAL OFoFr TdiHspEosAinPgPoLf pIAacNkaCgeEand the · For dispoaspinpgliaonfceppalecaksaeggeo atonadrtehcyecling center.
applianceThpelreeafosree gcuot otoff athreepcoywcelirnsgupcpelynctaebr.le Thereforeancdutmoafkfetthhe dpooowr celor ssinugpdpelyvice cable andunmuasakbelet.he door closing device unusable.Cardboard packaging is manufactured from recycled · Cardboarpdappear caknad gshinoguldisbme dainspuofsaecdtiunrtehde wfraosmte paper recycled pcoallpeectrioannfdorsrhecoyucllidngb. e disposed in the waste papByeerncsoulrlinegcttihoisnpfroordurectciys cdliisnpgos.ed of correctly, you · By ensurinwgillthheilsp ppreovdeuntcptoistedntisiapl onesgeadtivoefccoonrsreeqcutelnyc,es you will hfeolrpthperenvveirnotnpmoetnetnatnidalhnumeganathievaelth, which could consequeontcheerswfioser btehecaeunsevdirboynimnaepnprtoapnriadtehwumastaen health, whhaicnhdlicnoguolfdthoisthperordwuicste. be caused by inapproprFioartmeowreadsetetaihleadnindfloinrmgaotifotnhaibsopurtordecuycltin. g of this · For more pdreodtauiclte, dpleinafsoe rcmonataticot nyoaubr looucatlrceitcyyocfflicnegaondf this produyocut,r pholeuasesheocldownatastcetdyisopuosrallosceravliccei.ty office and your DhIoSuPsOeShAoLl:dDwo ansotteddisipsopsoestahlisseprrvoidcuec.t as · DISPOSAuLn:sDorotendomt duinsipciopsael wthaisstep.rCoodllueccttion of such as unsortwedasmteusneipcairpaatel lwy afosrtesp. eCcoiallletrcetaiotmneonft is such wasnteecseespsaarrya. tely for special treatment is necessary.

7

5

esatto.house

YoPuRrODDiUshCTwOaVsEhReVrIEW
ImportaPntR! OIMDPOURTCANTT:OVERVIEW
To get the beTsot gpeetrftohrembaensctepferrofmormyoaunrcdeisfhrowmasyhoeur,rrdeaisdhwalal sohpeerr,arteinagd ianlsl torupcetriaotninsgbeinfsotrreuuctsiionngsit
for the first tbimefeIoM.rePuOsinRgTitAfNorTth: e first time.
To get the best performance from your dishwasher, read all operating instructions before using it for the first time.

InInnneerrppiippee Inner pipe
DDisisppeennsseerr Dispenser
Cutlery basket

Upper basket

Lowweerrsspprraayyaarrmm Filteerr aasssseemmbblyly
Lower spray arm Filter assembly
Lower basket

Cutlery basket

Cup rack

upper spray arm

Upper basket

Lower basket

GClausps rraacckk

Uuppppeerr sspprraayyaarmrm

NCuOtleTryEb:asket

Upper basket

Lower basket

Pictures are only for reference, different models may be different. Please prevail

iNn kOindT.E:

Pictures are only for reference, diffe6rent models may be different. Please prevail in kind.

6

NOTE Diagrams and pictures in this manual are only for reference, your appliance may appear differently.

User Manual

6

QUIQCKuUiScEkR GSUtIDaErt Guide
QUICK USEQRUGICUKIDUESER GUIDE PleaPsleearesaedrtehaedcothrreescpoornredsinpgocnodnitnegntcoonnttehnetininsttrhucetiionnstmruacntuioalnfomradneutaaillefdor detailed operating method. QUICK USEQRUGICUKIDUESER GUIDE operating method.
PleSasTeErPea1d: the corresPploeansdeinrgeacdonthtenctoorrnesthpeonindsitnrgucctoionntemntaonnuatlhfeorindsetrtuacilteiodn manual for detailed oPpleearasetinregamd eththeocdo.rreosPppleoeanrasdetiinnrgegacmdoenthttheoncdto.orrnestphoenindsintrguctoionntemntaonnuatlhfeoirndstertuacilteiodn manual for detailed operating method. operating method.

1 Install the dishwasher
(IPnlsetaaslel cthheeckdisthhewsaescthioenr. 5R”eIfNeSrTtAoLLthAeTIIOnNstIaNlSlaTtRiUonCTIInOsNtr”uctions section of this manual.

1 1

oSI(nfPITnslPsteEAataaPlRlsllteT2hthce:ehde:discGishkhewwntaehasreshihcesere1Vr1cetriI(nsoIPnisnlostetana5al.lls)l”tethIhNceehSdeTdiscAishkhLwwLtaAhasTsehhIeOsererNctIiNoSnT5RU”ICNTSITOANLL”ATIOLSNoTaIENdPSTt3Rh:UeCdTIiOshNw”asher

baskets.

Ro(efPmlPeAaoRsveTechae:ncGykelntaehrregicseeVcretoer(isofPsilnPoiedAna5u.Rs)”eeTINchSeT: cAGkLeLntAheTreiIcOseVNcetIriNosinSoTn5R.)”UICNTSITOANLL”ATION INSTRUCTION ”

of PART : Generic VeorfsiPoAnR.)T : Generic Version.)

Inside

Outside

2 Removing the larger residue on the

3 LoadinIngsitdhee baskeOtsutside Inside

Outside

cutlery

Inside

Outside Inside

Outside

2 oRnemthoveindgitshheelasrg&ercr2uestildReueremyo. nvinthgethe large3r reLsoidaudeinogntthhee basket3s Loading the baskets

2

cutlery Removing

the

larger

r2escidRuuetlmeeroynvinthgethe

large3r

reLsoidaudeinogntthhee basket3s SLToEaPdin5g:

the

baskets

ScTuEtlePry4:

cutlery

Fill the dispenser.

Select a program and any optional settings and then run the dishwasher.

4 Filling the dispenser

5 Selecting a program and running

the dishwasher

4 Filling the dispenser 4 Filling the dispense5r Selecting a program a5ndSreulnecntiinngg a program and running

4

Filling the dispenser 4

Filling the3dispense5r

the dishwasher Selecting a program

a5ndtShreeulendcnitsiihnnwggaashperor gram

and

running

the dishwasher

the dishwasher

3

3

3

3

7

esatto.house

Control Panel

1

2

3

4

5

6

7

8

KEY

1. Program indicators *

Intensive For heaviest soiled crockery, such as pots, pans, casserole dishes and dishes that have been sitting with dried food on them for some time. Heavy For heavily soiled loads, such as pots, plates, glasses and lightly soiled pans. ECO This program is for normally soiled loads at rated capacity.
Super 90′ A fast 90 minute daily program for lightly soiled dishes. Rapid A quick 30 minute wash suitable for lightly soiled dishes. This program does not include a drying stage.

2. Program

Select the appropriate washing program, the selected program indicator will be lit.

3. Delay indicators

To show the set delay settings (3h/6h/9h).

4. Delay

Press this button to increase the delay start time. You can delay a cycle 3, 6 or 9 hours later.

5. Extra Drying

For better drying results (Cannot be used with Rapid program).

6. Extra Drying indicator To show if the Extra Drying setting is selected.

7. Power Button

Press this button to turn on your dishwasher on and off.

8. Warning indicators

Rinse Aid If the ” ” indicator is lit, the dishwasher is low on dishwasher rinse aid and requires a refill. Program End If the ” ” indicator is lit, it means the Program Cycle has finished.

AS/NZS 2007.1: This program is the test cycle. The information for comparability test in accordance with AS/NZS 2007.1

hind it, and the sides, along the adjacent cabinets or walls. The dishwasher is uipped with water supply and drain hoses that can be positioned either to the right the left sides to facilitate proper installation.

evelling the appliance User Manual

8

nce the appliance is positioned for levelling,

Installation Instructions e height of the dishwasher may be altered
justment of the screwing level of the feet.

IvNia STALLATION

INSTRUCTION

any case, the appliance should not be inclined WARNING

ore than 2°. WARNING:
ELECTRICAL SHOCK HAZARD
NOTE: Disconnect electrical power before installing dishwasher.
Only apply toFatilhureeftroedeosstoacnoduildngresduilsthinwasher.
death or electrical shock.

ElecWtrAicTaElRShSUoPckPLHYaAzNarDdDRAIN Disconnect electrical power before instaClloinldg wdiasthewr acoshnenre.ction FailuCreontnoedctothsoe ccooludlwd arteesrusltupinpldyehaotshe otor a threaded elect3tri/gi4chaitnllycshihnocpoclknan.ceec. tor and make sure that it is fastened

Attention If the water pipes are new or have not been used for

Water Supply And Drain IMPORTANT!

The installation of the pipes aannd eelexcttericnadl eeqduippmeernitos dshooufldtibme deo,nleebtytphreofewssaiotnealrs.run to make

The installation should be done

of by

tphreofpeispseiosnaanlds.electAricbaloequutipPmoenwts erstouCraeovtonhidanttehthecertwisikoatonefrtihsecwleaatr.eTr hinisleptrteocbaeutbiolonciksendeaendded

damage the appliance.

old water PcOoWnEnR CeOcNtNioECnTION

WARNING NOTE: Please close the hydrant after use.

nnect the coldWwAaRtNeIrNsGu:pply hose to a threaded 3/FD4oo(rinnpcoehtrs)uosneaal nsaefexttey:nsion cord or an adapter

nnector and mFaokr eyosuurrpeertshoantalitsaifseftya:stened tightly inpplulgacwei.th this appliance.

heendweadteprepriiopde··soaf rDDwttehiooimetnhnneeeoota,httwr,itluseuhsoanitenpdrgtapehhncrlieaoaaenvnxnwnectyeeeacnnc.tistreoiicoortunnmrbucfersonoteramdntnooctuhremessa,enpacdoaukwdtefeaoorpsrrDtuctrhaeeoorermnerdnpeo.tloauvhtreg,athutinndgecroannnyeccitricounmfrsotamnctehse,

cut or power

remove cord.

e water is clear. This precaution is needed to aEvleocitdrictahlererqisukireomfents

e

water

inlet

toEPllbeeacesterbicllooaoclkkreaeqtduthiarenermdateidnnagtsmlaabegletothkneowaPtpoltepthahseleiaalropaonpktrcioanpetgrti.hateerpatoinwgerlasbueplptloy.kUnsoewththeereraqtuinirgedvofultsaege10aAn/d13coAn/1n6eAct,

the dishwasher time delay fuse

voltage and connect the dishwasher tor tchirceuit breaker recommended and provide separate circuit serving only this appliance.

NOTE: atipmperodperlaiaytefupsoewoerrcsirucpupitlyb. rUesaekethrererceoqEmuleimrcetedrnifcduaesldeco1a0nnAnd,ectionPOSITIONING THE APPLIANCE

Please

close

tphreovhidyedsreapnatraateftceirrcuuistinsegrv. ing

only

tEhnissuraepthpelivaolntacgee.and frequPenocsyiotifothne tphoweear pbepinlgiacnocrreesipnontdhsetodtheossiereondthloe cation. The rating plate. Only insert the pbluagcinktosahnoeulelcdtrircealsstocakgetawinhischt itsheeartwheadll behind it, and the

Position The Appliance Electrical connection

properly. If the electrical sockseitdtoesw,haichlotnhegatphpleianacde jmaucstebnetcconanbecinteedtiss noort walls. The

Ensure the voltage and frequency of thapeprpooprwiateerfor the plug, repdlaicsehthwe asoschkeetr, riastheerqtuhaipn puseindg wa aidthaptworas toer rthseulikpepalsy and drain

being corresponds to those on the ratitnhegy pcolualdtec.ause overheatinghaonsdebsurtnhs.at can be positioned either to the right or the

PboeshiiOitftsnohionreedlnatyahirptiettn,hphspealeeildaunrntgapdct,prheortpeephmplepieluarlaulsnsycgt.iecdbIiefnteehttshiocen,eosanaoetnnhllcoeeekecnlceetttdgrce,itcedrrtaaishicltsiahresneeloosdarcotktdhcEaleojnkaptasecnptuctoarreueowtwnstiphihohntraiinigtcaccph.thaareoTbphienreeeabtrtslLOaheeicofnntvgkcreseeiwlsxdltihishena1tosse3glblutaseot.lpfhdofpeTraelhrciauaeiepslnsietpctdaeltiaiaesigshnpapcwriooenaspsiesttihrotiennhersedtiasfwlolaratlileol vne. lling,

equiapdpaepdterws oitrhthwe alikteerassuthpepylcyoaulnddcadursaeinovherohseeastintghat catnhebheeipghotsoitfiothneeddishewitahsehrertomathy eberiaglthetred via

or thaendlebfutrnssid. es to facilitate proper installation.

adjustment of the screwing level of the feet. In any case, the appliance should not be inclined

WARNING:

more than 2°.

LevEenslulrienthgattphroeperaeparpthliinag nexcisets before use

Once the appliance is positioned for levelling,

the height of the dishwasher may be altered via

adjustment of the screwing8level of the feet.

In any case, the appliance should not be inclined

more than 2°.

NOTE:
Only apply to the free standing dishwasher.

Water Supply And Drain
Cold water connection
Connect the cold water supply hose to a threaded 3/4(inch) connector and make sure that it is fastened tightly in place.

9

esatto.house

Installation Instructions (Continued)

WARNING: A hose that attaches to a sink spray can burst if it is installed on the same water line as the dishwasher. If your sink has one, it is recommended that the hose be disconnected and the hole plugged.

How to drain excess water from hoses If the sink is 1000 higher from the floor, the excess water in hoses cannot be drained directly into the sink. It will be necessary to drain excess water from hoses into a bowl or suitable container that is held outside and lower than the sink.

DRAIN HOSE CONNECTION

Water outlet

Connect the water drain hose. The drain hose must be

Insert the drain hose into a drain pipe with a minimum correctly fitted to avoid water leaks. Ensure that the

diameter of 4 cm, or let it run into the sink, making

water drain hose is not kinked or squashed.

sure to avoid bending or crimping it. The height of

drain pipe must be less than 1000mm. The free end of Extension hose

the hose must not be immersed in water to avoid the If you need a drain hose extension, make sure to use a

back flow of it.

similar drain hose. It must be no longer than 4 meters;

otherwise the cleaning effect of the dishwasher could

Ensure that the drain hose is securely fixed in

be reduced.

either position A or position B.

Syphon connection

Connection Of Drain Hoses The waste connection must be at a height less than 100 cm (maximum) from the bottom of the dish. The water drain hose should be fixed.

Insert the drain hose into a drain pipe with a minimum diameter of 4 cm, or let it run into the sink, making sure to avoid bending or crimping it. The height of drain pipe must be less than 1000mm. The free end of the hose must not be immersed in water to avoid the back flow of it.

Please securely fix the drain hose in either position A or position B

Counter

MAX 1000mm

Back of dishwasher

A

Drain hose

B

Mains Cable

Water Inlet Drain Pipe

How to drain excess water from hoses
If the sink is 1000 higher from the floor, the excess water in hoses cannot be drained directly into the sink. It will be necessary to drain excess water from hoses into a bowl or suitable container that is held outside and lower than the sink.

The height will then be reduced to 815 mm, as scheduled by the International Regulations (ISO) and the dishwasher will fit perfectly under the kitchen working top

Built-In InUsstear Mlalanutalion(for the integrated model)

10

Installation Instructions (Continued) Step 1. Selecting the best location for the dishwasher The installation position of dishwasher should be near the existing inlet and drain hoses and power cord. STEIPllu1s: trations of cabinet dimensions and installation position of the dishwasher.
SELECTING THE BEST LOCATION FOR THE DISHWASHER
The1in.stLaellsastiothn apnos5itiomn mof dbisehtwwaesehner tshhoeutldopbeonfeadristhheweaxsishtienrg ainnledt acnadbdinraeitn ahnosdesthanedopuotweerrdcoorodr. 1. Lessatlhigann e5dmtmobceatwbieneentt.he top of dishwasher and cabinet and the outer door aligned to cabinet.

90 °°

90 °°

882200mmmm

Electrical, drain
aEnldecwtraictaelr, dsurapinply alinndewenaterar nsucpepsly line entrances

8800

580mmmm

110000 SpSapcaecebebtewtweeenencacabbinineett
bottobmottaonmd aflnodorfloor
600 mm(fo60r 06m0cmm model) 450 mm(for 45cm model)
2. 2If.diIsfhdwiashshweraishinesrtaislleidnastttahlelecdoranterthofethceocrnabeirneotf, tthheerecsahbouinldet, be stohmeerespsahcoeuwldhebnethseodmooer sispoapceenewd.hen th1e9 door is opened.
NOTE: Depending on where your electrical outlet is, you may need to cut a hole in the opposite cabinet side.

DDiisshhwwaasshheerr CCaabbinineett

DDdiiosshohDwrwooaaofssrhheerr

NOTE:

MiMnoiinmf i5mu0muommfs5mps0pamacceme

Depending on where your electrical outlet is, you may need to cut a hole in the

opposite cabinet side.

Step 2. Aesthetic panel’s dimensions and installation

The aesthetic wooden panel could be processed according to the installation drawings.
Semi-integrated model
Magical paster A and magical paster B be disjoinedon, magical paster A on the aesthetic wooden panel and felted magical paster B of the outer door of dishwasher

del
esthetic wooden panel and put the hook into the slot of the er (see figure A). After positioning of the panel, fix the panel screws an1d1 bolts (See figuerseattBo).h.ouse

Installation Instructions (Continued)

FuSlBlT-EinP t21:e.gTraatkeedamwoadyethl e

four

short

screws b) Install

the

four

long

screws

AESTHETIC DOOR PANEL INSTALLATION

Install the hook on the aesthetic wooden panel and put the hook into the slot of the

This appliance is integrated and does not include
oounttacpeoFoadnrnuottedoahlllrcoie- ntpioanayoronktuueioettlrc.fegchBrhdereonfadiossctoerheaenowbidfnriinnasbetimssatyhhmll.ieosancrgkder(tereshtweisolepsorrfoagidganunudcisrteebpaloAedlat)os.seoAr(SfeteerfpigousriteioBn).ing of the panel, fix the panel
Install the hook on the aesthetic wooden panel and put the hook into the slot of the

tNeoOmuTptElea:rtRedefofoerorprtaoontfehledmaiseehaswtshuearetsimcheednorto(srs.epeanfeigl iunsrtealAla)t.ioAnfter positioning of the panel, fix the panel

A

onto the outer
1. Install the hook

door
on the

baeystshcerteicwdsooarnBpdanbe1ol.ltTsa(kSeeaewfiagyutrheeBf)o. ur

short

screws

and put the hook into the slots on the outer door

of the dishwasher.

A

B 1.Take away the four short screws

el

2.Pin up StThEeP 3f:our long screws

esthetic

wooden

panel

and

put

the

hook

into

the slot of the ADJUSTING THE DOOR SPRING TENSION The door springs are set at the factory default

tension

r

(see

figure

A).

After

positioning

of

the

panel,

fix the panel for the outer door. Once the aesthetic wooden panel
is installed, y2ou.Pwinill huapvethtoe afdojuurstlothnegdoscorreswprsing

crews and bolts (See figure B).

tension. 1. Rotate th2e.aPdinjuustpintghsecfreowurtolotnigghstecnreowr sloosen the

2. After positioning of the panel, fix the panel onto

steel cable.

adjustment of the door spring the outer door by screws and bolts.

2. Door spring tension is correct when the door

SBtep1a).3RTea.mkoTeveeatnhwesafoiyuortsnhhoeratfsodcurjeruwssshtomrt escnretwosf

the door spring remains horizontal in the fully opened position, yet rises to a close with the slight lift of a finger.

set at th1.eTSfhtaeecdptooo3r.ysTptreionngssiaorne saetdajtutshtemfaectnotryotof the door spring

onr etlhaereouintestaw1htre.iaeslldtTalphhlheoereaseottvdophipdecre,reootw.rooipycrtoeIoeafwsronpdutodrsejuoieinnodnssgnteisopntfnahaoprenfreaoedtnsrlheeotaetlhoraaeerortuesoitnptuhiesnrtetiresnatfrdgalaldolecltoetdoeodo,rnr,r.yy.syIoifItofouun.

e door sprRiontagwtielltthehanevesaitdoojunasdt.jiunsgt tshceredwootor sdprivneg thenesion.

screw to2. daDdroijouvRarsedotsjtoupatrstrhteitonoetrghsteottreaasndtirnsjauioiosnntrinorisgrerlcsaeocxlarrerxtewhtcehtteoswtsdethereeievlnleccattahbhbeleele..

elax the sdt2eo. oeDrloroecmrasabpirnliensg.htoernizsoionntaisl cinortrhecet fwuhllyenotpheened

nstacloirnretchtewpliffouthsodplileitlffooiytonosaonirtoffi,toriaenyphnmegf,eeitenaynrregin.itseeserr.ihdsseotsoriztaooncatlaocllsoiensewthwietihtfhuthltlhyeeospslilegignhhettd

a close with the slight

2.Pin up the four long screws

adjustment of the door spring

Please refer to the specified installation steps in the installation drawings.

1. Affix the condensation strUipsuenrdMeratnhueawl ork surface of cabinet. Please ensure the

12

condensation strip is flush with edge of work surface. (Step 2)

Installation Instructions (Continued) 2. Connect the inlet hose to the cold water supply.
3. Connect the drain hose.

4. Connect the power cord.

5. PlaScTeEPth4e dishwasher into position. (Step 4) 6. LeDvIeSlHthWeAdSHisEhRwIaNsShTeArL. LTAhTeIOreNaSr TfoEPoSd can be adjusted from the front of the

dis1.hwAPalfefsiaxhsteehreenbcsyounrteduetrhnnesianctogionndthestnersipaPthuionilndipessrtrtishpceirswefwolurskihnswutrihftaheceemdogifedcdoaflbewinooerftk.tshuerfabcaes. e(Sotefpd2i)shwasher

us2e. aCnoPnnheilcitptshescinrelewt h.oTsoe taodthjuesctotldhewaftreornstupfepley.t, use a flat screw driver and turn the fro34.n. tCCfooennennteeuccttnttthhieel tpdhroaewinedrhiscohoserwd. .asher is level. (Step 5 to Step 6)

7. Ins56t..alPLlelatvhceeel tthfhueerddniissithhuwwraaesshhdeeorr.oiTnrhtoetopreotashritefieooentu. ctaenr bdeoaodrjuosftetdhferodmisthhewfarosnhteorf.t(hSetdeipsh7watsoheSrtebypt1ur0n)ing the Philips

8. Adjusstcrtehweintethnesimoinddolef otfhtehedboaosre sopf driinshgwsabshyeur suisneganaPnhAilipllsenscrkeewy. Ttourandijnusgt tinheafrocnlotcfekewt,iusese a flat screw
driver and turn the front feet until the dishwasher is level. (Step 5)
m7o. tioInnstatoll tthige haetestnhetthicedloeofrttaonthderoiguthetr ddoooor rofspthreindgissh.wFaasihluerr.e(Sttoepd7otothStisepc1o0u) ld cause

da8m. aAagnddejurstitogthhyteodtoueornrsdsiopisnrhinowgf stah.sFehadeilouro.rre(sStpotredinpogts1hb1isy)cuosuinldg

an Allen key turning in cause damage to your

a clockwise dishwasher.

motion to (Step 11)

tighten

the

left

9. Th9e. dTihsehwdisahswhaesrhemr umsutstbbeesseeccuurreeddininplapclae.cTeh.eTrhe earreetawroewtawyos two daoysthtiso: do this:
a. Normal work surface: Put the installation hook into the slot of the side plane and secure it to the work
A. Normsuarlfawcoerwkitshutrhfeawceo:odPusctrethwes.installation hook into the slot of the side plane and

sebc.urMFeixairtthbetleosoidtrhegerwawinthitoeSrcwkroesrwuk.rtfoapc:e with the wood screws.

B. Marble or granite work top: Fix the side with Screw.

AA

BB

22

13

esatto.house

Installation Instructions (Continued)

Step 5. Levelling the dishwasher

STEP 5
DishwasheLrEmVEuLsLtIbNeGlTeHveEl DfoISrHpWroApSeHrEdRish rack operation and wash performance.

1. Place a Dspisihrwitalsehveerlmounstdboeolervealnfodr rparocpketrrdaicshkriancskidoepetrhateiotnuabndaswsahshopwenrfotromcahnceec.k that the

dishwas12.h. ePLrelaivsceelletahvesepld.irisithlwevaeslhoenr

door and rack track inside the tub as shown to check by adjusting the three levelling legs individually.

that

the

dishwasher

is

level.

2. Level th3e. dWishhewn alesvheel trhebydisahdwjuasshtienr,gpltehaesethpareyeatlteevnetilolinnngotletogsletinthdeivdidisuhwalalysh.er tip over.

3. When leNvOeTl Et:hTehedimshawximaushmeard, jpusletmaesent hpeaigyhat totfetnhetifoenetniso5t0tmomle.t the dishwasher tip over.

CfrhoefnCrcothknettcoltekovblbeeaavlecclkk

CsihdCsieehdceetkcotkollesseiivvddeeeell

UP DOWN

NOTE:
The maximum adjustment height of the feet is 50 mm.

23

PROGRAMMUseIrNManGual THE DISHWASHER 14
WOpaeshraCtyiocnleITnasbtrluections
WASH CYCLE TABLE
TThheetatbalbe lbeelbowelsohwowsshwohwichspwrohgricahmsparroegbreastmfosr tahreelebveelsstoffoforodthreesildeuveeolsn of food residue
them and how much detergent is needed. It also show various information about
tohne ptrhoegrmamasn. d how much detergent is needed. It also show various information about
(the) RpinrsoegAriadmreqs.uired
( )Means: need to fill rinse into the Rinse-Aid Dispenser.

Program

Description Of Cycle

Detergent Pre/Main

IInntteennsivseive

Pre-wash(50) Wash(60) Rinse Rinse Rinse(65) Drying

HHeeavayvy

Pre-wash(45) Wash(55) Rinse Rinse(65) Drying

(**AESC/ONZ5S02°0C07.1)

Pre-wash Wash(45) Rinse(50) Drying

5/25g
(Or all in 1)
5/25g
(Or all in 1)
5/25g
(Or all in 1)

Su9p0erM90in’

Wash(65) Rinse Rinse(65) Drying

30g
(Or all in 1)

Wash(40)

Rinse

25g

QuRicakp3i0d’

Rinse(45)

Running Time(min)
170
160 170 90 30

Energy (Kwh)
1.6
1.4 0.69 1.2 0.6

Water Rinse

(L)

Aid

18.5

15 10.2 11.5 11.5

NOTE:

AS/NZS 2007.1: This program is the test cycle. The information for comparability

NOTE: *AS/NZS 2007.1:

This isttehsetpirnogaracmcoforrdaannocrme awllyitshoilAedSl/oNadZSat2ra0te0d7c.a1p.acity. This program is the test
cycle. The information for comparability test in accordance with *AS/NZS 2007.1.

12

15

esatto.house

Operation Instructions (Continued)

STARTING A CYCLE WASH

ADDING A DISH MID-CYCLE

1. Draw out the lower and upper basket, load the

A forgotten dish can be added any time before the

dishes and push them back. It is recommended to detergent dispenser opens. If this is the case, follow

load the lower basket first, then the upper one.

the instructions below:

2. Add the detergent.

3. Insert the plug into the socket. The Power supply

1. Open the door a little to stop the dishwasher.

refer to the Technical Specifications section.

After the spray arms stop working, you can fully

4. Make sure that the water supply is turned on to

open the door.

full pressure. 5. Open the door and press the Power button to

2. FAodrdgtehte aTdodiAtiodndal dAishDeiss.h?
3. Close the door.

switch on the machine. 6. Choose your wash cycle settings and the
corresponding the indicator lights will illuminate.
S7.taTrhteinnpgreAss cCloyscelteheWdoaorsahnd the dishwasher will
begin its cycle.
1. Draw out the lower and upper basket, load the dishes and push them back.
It is commended to load the lower basket first, then the upper one.

4. A Tfohrgeottdenisdhishwcaansbheeadrdwedialnlyrteimseubmefoereitthse dceytecrgleent dispenser opens. If t1h.aisOfisptteehnertch1ae0sed,osfooerllcaowolittntlhedetosin.ssttorupctthioenws baeshloinwg:.
2. After the spray arms stop working, you can open the door completely.
WA3. RAdNd IthNe Gforgotten dishes. It i4s. dClaosnegtheerdooour.s to open the door mid-cycle, as hot ste5a. mThemdisahwyasshcerawlidll ruynoauft.er 10 seconds.

2C. HPoAur Nin GtheINdetGergTenHt. E PROGRAM MID-CYCLE 345Arm…uaMIOCnwnhpsyaneaoekrinoehtsnsttshaeghhueeavrcefepdpoytlorhuorcaoaggrltla,rierantthemotsoceua,hcawttdhhhoaneetytrhesrtooerebscstnPpkueioeolmpweytnp.esnleTyebrhiblresoeiguetpthtuclthotreohnwwenaeae.irdlsrlwnotesuugndirpsnetpoeaoldyf,nnur.itelldfThfpehierrettenthsohdsceullaeaoresdsstt.eeipbtsrahhggeeeweed”onnaPotrrso, dhthueectrfiche”. madisyhwhaashveer wailllrsetaartditsycydclrea. ined the wash water. If this is the case, the dishwasher needs to be reset and the

WARNING

Cddeihstheawrngaesgnhtiendr,igsfopleTlonhwseetrhmPe urinosstgtbruercartemiofinllseMdb.eiTldoow-rce: ysectltehe

It is dangerous to open the door mid-cycle, as hot steam may

At1h.ewdaseOhtecrpgyceelnentcmatnhayoenhladyvbeoeaolcrrheaaandgyleibdteteiflneitrehtlaoesasbseetdeonapnrdutnthnhieengddisfohirswahasswhheoarrtmsthiamyeehrao.vtheearlwreiased,y draineAd fthteewr atshhewastperr. aIf ythias irsmthescsatseo, pthewdoishrwkainshger,nyeeodus tco abenrefsuetllaynd the detergoepntednisptehnseerdmousot rb.e refilled. To reset the dishwasher, follow the i2ns.trucPtiroenssbselpowro: gram button for more than 3 seconds

scald you.

1. Opaenntdhetdhoeorda ilsitthlewtoasstohpethrewdisihllwraeshteur,ranftetrothae ssptraaynadrmbsytopstwaotrkein.g,

3.youYocaun ocpaennthtehdeonorccohmapnlegteely.the program to your desired 2. PrecssyPcrolegrasmetbtuitntogn.more than three seconds the machine will be in stand by 4.staCte.lose the door to begin the new cycle.
3. You can change the program to the desired cycle setting.

3 sec

14

13

User Manual

16

Preparing & Loading Dishes

Load hollow items such as cups, glasse downwards so that water cannot colle Dishes and items of cutlery must not lie

To avoid damage, glasses should not to

· Consider buying utensils which are identified as dishwasher-proof.
· For particular items, select a program with the lowest possible temperature.
· To prevent damage, do not take glass and cutlery

The upper basket is designed to hold m

· Long bladed knives stored in an uprightgplaossseist,icoonffee and tea cups.

are a potential hazard!

Long bladed knives stored in an uprigh

· Long and / or sharp items of cutlery sucLhonagsand / or sharp items of cutlery su

carving knives must be positioned horizohonrtizaolnltyally in the upper basket.

in the upper basket.

Please do not overload your dishwashe

out of the dishwasher immediately after the

· Please do not overload your dishwasher.reasonable consumption of energy.

program has ended.

This is important for good results and for

CUTLERY/DISHES SUITABILITY The following are not suitable

reasonable consumption of energy.

NOTE:

NOTE: Very small items should not be washVeerdy simnatllhiteems should not be washed dishwasher as they could easily fall out of thouet bofathsekebats.ket.

· Cutlery with wooden, horn china

or mother-of-pearl handles · Plastic items that are not heat resistant · Older cutlery with glued parts
that are not temperature resistant

Removing the dishes

Removing the dishes

To prevent water dripping from the upperTobaprsekveentt winattoer dripping from the upper

the lower basket, we recommend that youreceommmpetnydtthhaet you empty the lower bas

lower basket first, followed by the upper basket.

· Bonded cutlery items or dishes · Pewter or copper items

WARNING

WARNING

· Crystal glass

Items will be hot! To prevent damage,

Items will be hot! To p

· Steel items subject to rusting · Wooden platters

do not take glass and cutlery out of the Loading theduisphpwearshbearsfkoer taround 15 minutes after

cutlery out of the dishwa program has ended.

· Items made from synthetic fibers

The upLpoerabdaisnkegt titshhdeeespuigrpnoegpdreatrombhoahldsaksmeeotrneddeedlic.ate and

T·· heSSatofofioltvmdeleliresoracwatoylnialpnodregugasrealoudnrfmueugrmiionlnafubgsmlesiwrmepasoiasftcherwatidnnsagshsbuhaeeivctseaombaietlietdnyudlel nlapdtihcgnaisehydnhtsseespsa(raruTlapdtaadishghnaicnysielhseednhodhotrsseunesspwfcsa(rp,garowuaapadasocanyreisalseeksodrhotrwwnesbtswfc,hgrueaoLThdcaw.aaeslcoralorooihskaeyhekssaetfwleawehassttdsfahrouereadiws.puseelcrmlelteygihdpaaanhnleatssaoaapoaresorgssptetiernsegsltg,ettaennhtdrhsolstsaheoaemeduob,sdtttseyscce,eatatedthoowsolhslaisulmeofir,cfitkyhbcplaeyacdlooaoew)leinplsul.frwdttfitbolPpeyeelgaloimt)oesns.nsrwlagsooaaPdiadlbeatrtonnssneittgseodnaadsdeidemtnnsedaisstetodilheotlskgimncihasgcasv,uenhaoetaelchplhtavotdeueuseetlwpldoedbacswnyrebtdyors, as well as plates,

· Glazed patterns may fade if machine

small bowls and shallow pans (as long as they are not

washed frequently

LoadLionagdtinhgettlohooewdleoirrwtybe).arPsbokaseistktioent the dishes and cookware so that

SrrFlTRoeiocnHEamrrsCdEaebnipOneDatehgsMnIteSotgsMpfHdufeoiiWEasdrfhfNneboAeylDurisSnmlrAaHnuearTstnEgn.IdfReOcoeeoarNdmorSufionntFuhnpOneiantRdsngisLosw.OhfIawtlAetiaefsDtrson.IhNvoeetGrr,nffeoocolleWdbasaTdodesvhsiaefwr.eosetsfsveikiShacisdmnretuuogorgthblgawy:eWdbasaTdotflexegdnsvhtiaeposntfireotueesetsomitfescvseoikihscinkciesdnhdmnnreucthuuoiigneigtnlbmslgawtet:etgsaghplhxgdnasontsiaaeueeoomitndctstnncsipkfhhdinfcutahiidsyoieieitnltgmstLW ictpfmeteteos.tathpgihhhlrruasmluioasegaaeeoede,ndrteeietnnptsmhtenuassippfaeaiyadsyoeitollasgrsaomedrbeotnatoselifnrru,rsuwnmeuiaoceoide,wrsi1aelilndgtsntessobppt,tiieat9vhdlnoeelagglwaoolrbteoalaiieifnrsdncsdremaocerf.enlbes1meltgsd,onso,tsbtIde,oht9ittvheshlwsdwol,toaiishaetisdepfeceeitserf.abeottm.egshslsgrretIatdhep,rotirelvhkiIodv,mcsesoermtifaippfeeepnitseeeiotnthlwlstnritedfgatatptrohovsisooemcsm:aogtrifyppeiepntrdeeesnnpnsalstrodfgasitthrbdordasotseburoaatupoehiyirtdedveeilnnnbcctaersesihtrhdaetaksbfipohahsaohfhpfaiyteerslndrctfeomleemhaeohstaklriaiamshfnaantcersanspbkl.rpomcsemoaodctouilombeeynanawenpl.pspeorrolbcdlttolttodneetaefwedtoolsorrbhecrhadtttdweftetorthoeeierrhstownletbgrhse,os,tletoespoop,wlraalcsye, oasfsewrsvhaLTlapiighnaoonthednateswguesda(rparupids.ndcneilseorhgrinsbiws,gnataashahrskesetweettshhueisuselcleyhdpaeasapsrspiegelgannlrtaeoesdtsbs,tetoasosmo,shcadkoolillefrdftbeytom)e.woPalrosnesadidtnietodelniacshatchtaueelploaswnd7 3 opening of it. and lids on the side of the racks in order to avoid dishes and cookware so that they will not get moved by

· ·

ICatreuemrvfsaecdseuidctehdmaossw,cnouwrpoasnr,degssl.awsistehsr,epcoetsss/epsa,nssh,oeLutolcda. dbLCeionutagledrytisnhhgoeubTtltcdhhhluobeeeectdlpmkceeluianatrcteegyxldreigtmibrnheyautenhmsbetrkoacdudetsitasiklteaptreimyeotrnnaecstkoeesfrretpiahsadreoavtfteisol1ye9pfdrocsmfpmorer,aactpyhhlaaiostrthemneLstWorh.oeietinasnspudttrghoaigfnyeerogshotf twtahnhaatmtteeyro.olpoufwpelaecrerlabrgaesikteemts and the most

·

loaded aslant so that water can All utensils are stacked securely

raunndocfaf.nCapnupotlretorptyacirapspiauhptsoreeouppblrdaoiadsbtietpeieoptprhnofloassei,rctmieaoodnanpndsi,ecnedant.nohidnemdgcaoukomtelfeasrkiuyter.resauctrhkeetsheuepteaunrtaesntilesslilydsofdroonmonot etnaneceshstttotootghgeettrdbahhsiafisfseenikhcreruo,t,tlw:thtstnthuoheciinchsilsetahmasmenpafioitagyetusmy,respaabnreeslo,twolid.bsIe,t

placed into the lower serving dishes and bowls, is preferable to place

WARNING over.

cause bad performLaonaced. ing the cutlery basket

serving dishes and lids on the side of the racks in order to avoid blocking the rotation of the top spray arm.

· All utensils are placed in the way that the spray

Cutlery should be placed in the cutlery rack The maximum diameter advised for plates in front of the

arms can rotate freely during washing.

WARNING separatelDy ofronmotelaecthaontyheitreinmtheextaepnpdrotphrdorepiteaoenritgnueegngot fdihits.penser is of 19 cm, this not to hamper the

·
· · ·

Load hollow items such as cups, glasses, pans etc.

With the opening facing downwards so that water

cannot collect in the container or a deep base.

Dishes and items of cutlery must not lie inside one

another, or cover each other.

To avoid damage, glasses should not touch

one another.

The upper basket is designed to hold more

For

theptDAeWobnologewAdssenitaRtdtowiyhNooDtAstsaehhnwIlsolrleNshewa,on,ttAsintGarwhnhaahbagpldewanoainyoesdsrryfsptbatfpdmhetdiyoolsaltcoeaospoe!ttri,ytnpmmtaoplmootcldaiuenm.eaaaantdxtkdseus.eytoenhsdelseswosoniahitaulbdwredasnrpaermttwn!dhhptue!irhtpoubehteeuaetxrtsegunkthfhntoeeesetrsnstinmslihrlssdheseaiaflwenswbtrrcphodtiiLCacetottaropouuhh.pttoasslroeeontdrpybuamtirtoasninahhdhgttgWode.pueepaenlthdroAhfrosebdierRtemisopcNantlunas,IccteeNal.dnedDtAGirnhdyoltoewhbemnbaacaoyuokstestkltestrelluyoeotrretmaactdahk.ensseuyphteaianrtasretilpesmlyduofretonemoxt

delicate and lighter dishware such as glasses, loadingNoOptTioEn:s on last section of PART : Generic Version

sharp point down!

coffee and tea cups.

For the bestFworasthhiengbefsftewct,apslheiansge leofafdectht,epblaesakseets refer to standard

loading optlRiooeancsdoomtnhmelasebtnasdsekactetiiotosnnroseffsePeArcrRetTidonin.: GtheeneLriocaVdeirnsigon For the best washing effect, please load the bask

8

loading options on last section of PART : Gener

In

8

8

C

P

P

R

D

17

esatto.house

Loading Recommendation
LLooaaddiinngg TThhee BBaasskkeettss AAccccoorrddiinngg TToo AASS//NNZZSS 22000077..11
Loading the baskets according to AS/NZS 2007.1:
111…UUUpPppPpEeeRrr bBbAaasSskkKeeEttT::

11 22

33

11

11

22

11

11

33

11

11

NNuummbbeerr 11 22 33

IItteemm CCuuppss SSaauucceerrss GGllaasssseess

222…LLLooOwwWeeErrRbbBaaAsskSkeKetEt::T

3.Cutlery basket:

4

5

66

55

44

3 NNuummbbeerr

IItteemm

66

1

44

DDiinnnneerr ppllaatteess

55

SSoouupp ppllaatteess

2
3.Cutlery basket:

66

DDeesssseerrtt ddiisshheess

66

66 2

77

CCuuttlleerryy bbaasskkeett

1

77

4

3

5

5

3

4

3.3C.uCtlUeTrLyEbRaYskBeAtS:KET

1

2

21 2

4 4 4 11994 4 4

212

N2umber

Item

1

1

Forks

11 1

1

5

3

2

Soup spoons

21 2

4 44 44 4

1

2

252

3

4

5

53

Dessert spoons

4

4

Teaspoons

5

Knives

2 12 111

3 3 3Infor3mati3on fo3r comparab5ility te5sts in5accordance with (*AS/NZS 2007.1 )

5

5CPoaspita5icointyo: f1t4hpe5laucpepseertbtiansgkset: lower p5osition

Number 1

Item Forks

2 12

3 3 3PRrinosge3raamid:3sEeCttOin3g: 6

55

2

Soup spoons

Detergent(Pre/main): 5g/27.5g Door is open at the end of the drying cycle for the d1rying p2erform3ance te4st 5
(Door position: Open 50 mm)
Information for comparability tesNtusminbearccordanItceemwith (*AS/NZS 2007.1 )

3

Dessert spoons

4

Teaspoons

5

Knives

Capacity: 12 place settings

1

Forks

29

Position of the Program: ECO

upper

basket:

lower

2positionSoup

spoons

Rinse aid setting: 6

3

Dessert spoons

De1terge2nt (P3re/ma4in): 55g/25g

4

Teaspoons

Door is open at the end of the drying cycle for the drying

(Door position: Open 50 mm)

5

Knives

Information for comparability tests in accordance with (*AS/NZS 2007.1 ) Capacity: 14 place settings Position of the upper basket: lower position Program: ECO
pRDeienrtsfeeorgareimdntsa(ePntrtecin/meg:at6ien)s: t5g/27.5g
Door is open at the end of the drying cycle for the drying performance test

Information for comparability tests in accordance with (*AS/NZS 2007.1 )

(Door position: Open 50 mm)

Capacity: 12 place settings

Position of the upper basket: lower position

29

Program: ECO

Rinse aid setting: 6

Detergent(Pre/main): 5/25g

Type 2:

User Manual

Type 2:

18

Basket Tips

1 To raise the upper basket, just lift the upper basket at the center of each side until the basket locks into place in the upper position. It is not

2 To lower the upper basket, lift the adjust handles on each side to release the basket and lower it to the lower position.

necessary to lift the adjuster handle.

ADJUSTING THE UPPER BASKET

FoldingTF1boOTteahmoaLeccrhDkauaipsskIiepdtNeeehtrhuGebernaoutsicpBolkpteumhAetepraCbtbfatasohKsshkekreecetTtte,lalnojHuvtcleskletrEeslosiirfnftCtiotUemP sS2HinETaretodlLhejulaoVesswteEheutarhSpntehdpbeleaeusspkropenbteeraaanbcdashsklkoseiewdt,ete,lritfoitt

the to

The height of the upper basket can be easily adjusTteodmake roroamipslaefcoertihtnaetllheecr uiutpeppmerrspaioncsitkthioeun.upIptwpisenarorbtdassk.eYt,orauitsheceatlhonewectruhppeorsnaitciolkne.uapnwatrhdes. tall

to accommodate tall glasses in either the upper You can thgelnanlseecasenesstsahryeatgtoaallilftigntlhasestsaedistju.asgtYeaorinhuastncditla.e.Ynoau lcsaon arelsomreomvoeveititwwhheennititisinsot

basket or large cookware in the lower basket.

required fonroutser.equired for use. Folding back the cup shelves

To adjust the height of the upper rack, follow these steps:

To make room for taller items in the upper basket, raise the cup rack upwards. You can then lean the tall glasses against it. You can also remove it when it is not required for use.

STEP 1:

To raise the upper basket, just lift the upper basket at

the center of each side until the basket locks into
Typpelac2e:in the upper position. It is not necessary to lift

the adjuster handles.

FoldingFbOaLcDkItNhGe rBaAcCk KshTeHlvEesRACK SHELVES

The spikesTohf ethesploiwkeersbaosfketthearelouwsederfobr ahoslkdientg aplraetesuasneddafpolartthero. lding

They can bFpeollalodtwienesrgeadbntaodcmkaatkpheelmartoatreeckr.osoThmheeflovyrelcsaragne ibteemsl.owered to make

mTThheeroaysirspceeaiknuerpsboweoofalortmdwhseerlfoeodwretorlbmaaarskkgeeetmaoirtreeeurmsoeodsmf.ofrorholalrdginegitpefmlaotlsde.sbaancdkwa aprldastter.

raise upwards

fold backwards

1 TSoTErPai2s:e the upper basket, just lift

2 To lower the upper10ba1s0ket, lift the

tThoelouwpepr tehrebuapspkeer tbaastketht,elifct ethneteadr jousfter handles adjust handles on each side to

eoloanwceeharcsphiodsseiidtieuontno.tirleltehaesebtahsekbeatskloetcaknsdinlotwoer it to the release the basket and lower it to

place in the upper position. It is not

the lower position.

necessary to lift the adjuster handle.

Folding back the cup shelves
To make room for taller items in the upper basket, raise the cup rack upwards. You can then lean the tall glasses against it. You can also remove it when it is not required for use.

ft

2 To lower the upper basket, lift the

f

adjust handles on each side to

nto

release the basket and lower it to

not

the lower position.

dle.

elves
gauipnpsterit.bYaFsokouetlc,darnianiaselgsothbreeamccuokpvertaihct kweuhprewancaitrkdisss.nhotelves
The spikes of the lower basket are used for holding plates and a platter. They can be lowered to make more room for large items.

raise upwards

fold backwards

The rinse aid is released during the final rinse to prevent water from forming droplets on your dishes, which can leave spots and streaks. It also improves drying by allowing water to roll off the dishes. Your dishwasher is designed to use liquid rinse aids.

19 WARNIeNsaGtto.house

Rinse Aid & Detergent Only use branded rinse aid for dishwasher. Never fill the rinse aid dispenser with any other substances (e.g. Dishwasher cleaning agent, liquid detergent).

The Trinhsiesawid ios urelledasdedadmurainggethethfinealaripnspeltioance. FILLING THE RINSE AID COMPARTMENT

prevent water from forming droplets on your dishes, which can leave spots and streaks. It also improves drying by allowing water to roll off the dishes. Your

TSFoTiEolpPlie1nn: tghe TdishpeensRer,itnursnetheAcaipd Reservoir

When to refill the rinse aid dishwasher is designed to use liquid rinse aids.

to the “open” (left) arrow and lift it out.

WARNING

Rinse-Aid indicator

ThOenrlyeugseublararnidtyedorifnstehaeid fdorisdpisehwnasseherr.nNeeveedr fiinll g to be refilled depends on how often dishes are

the rinse aid dispenser with any other substances

wa(es.hg.eDdishawnasdhetrhcleearniinngsaegeanitd, liqsueidttdientegrguenste).d.

This would damage the appliance.

WThheen tLoorewfillRthine srienseAaidid indicator (

) will appear in the display when more rinse aid

Filling The Rinse Aid RFeilslienrgvoTihr e Rinse Aid Reservoir Tdiehspeenrneedgsueloadnriethydoow.f

the dispenser needing to be refilled often dishes are washed and the

1 To open the dispenser, turn the cap

2 Carefully pour in the rinse-aid into

Do not overfill the rinse aid dispenser. rinse aid setting used.
· The Low Rinse Aid indicator ( ) will appear in the display when more rinse aid is needed.

PnSooTutEtirttPoototh2uohet:ev. er”ironfpisleeln. “ai(dlefitn) taorrothweadndislpiftenser, beiniogtsvecdraifslropewefn.usel r, whilst avoiding it to

· Do not overfill the rinse aid dispenser.
Function of detergent · You should never let the rise aid level to be less than 1/4 full. · As the rise aid diminishes, the size of the black

Filling The Rinse AidNORTeE:servoir Clean up any spilled rinse aid with an absorbent cloth to avoid

The cdihllouetsmotrnaittcehdaelbrieinnlsoegwar:ieddleiveenl itnsditchataotr cchoanmgepso, asse the detergent are necessary to remewxaocsehvs.seive,focarmuinsghduarinngdthe next

dispeFnulsl e a3ll/4dfiurltl ou1t/2ofufllthe1/d4ifsuhllwaEsmhpetry. Most of the commercial quality detergents are

suiFTtuhanebccltheioemnfoiocrfadltiehntgiesrregpdeiuenntrtps othsaet .compose the detergent 1 3 ReRmepolavcee tthhee crianpsebyaiidnsreersteinrgvoitir cap

2 Carefully pour in the rinse-aid

are necessary to1 reRmemovoev,ectrhuesrhinasendaiddirsepsernvsoeir acallpdirt 2STCbEayaPrliergof3nut:ealldtyinwpgiothuitr”cioonpuetnhnte”erarcirnlrooscewk- awaindisdein. to

its dispenser, whilst avoiding it

out of the dishwashbeyrr.oMtaotisntgoitf ctohuencteormclomcekwrciisael. quality detergents are suitable for this purpose.
WARNING WARNING
Proper Use of Detergent · Proper Use of Detergent Use only detergent specifically made for Use only detergent specifically made for dishwashers use. Keep your detergent dishwashers use. Keep your detergent fresh and dry.
fresh and dry. · Don’t put powdered detergent into the dispenser until you are ready to wash dishes.
Don’t put powdered detergent into the dispenser until you are ready to wash · Dishwasher detergent is corrosive!

Cliotsstuedrinstpihneegnristientros,etwhaehiicdlslotrsaevdsoe(irrdivginohgti)raictrratoopw.by rAootdavj1etuirnfslgRoteiwinmt.gcolvotehctkehweriirsniens.see aaiiddrerseesrveorivr ocaipr

overflow. 2 Carefully pour in the rinse

NOTE: NOTE: by rotating it counterclockwise. The rinse aid reservoir Clean up any spilled rinrseecoamidmwenitdhed setting

hanasdsCatihxnleesaaefbntaiottcssviunoteodgprrrbisfys.aleopsBnneweoytntt.schisnpleogtirhlt,liheeswd”tho4rii”lnas.tvsIeofaitvadhoiedidw

NOTE: an absorbent cloth to advisohides are not drying propeerxlyceosrsaivree sfpooatmteidn,gaddjusrtintghethdeialn
excessive foaming durintogtthheennexetxht igher numberwunatsihl y.our dishes are spot-free.

wash.

Reduce it if there are sticky whitiCshlesatnainuspoannyyouspr idllieshdersinosre

a bluish film on glassware or kniafenbalabdseosr.bent cloth to avo

Kodfeiecshphildedirsseh.nw.asher detergent out of the reach 3 Close the rinse aid reservoir cap by

Adjust lever(Rinse)
3AdCjulossteinthgetrhineserianidsereaseidrvocior mcappabrytment

excessive foaming during wash.

· roTtuartinngthitecrlioncskewaisied. indicator dial to a number

rotatiDngiist chlowckwaisse.her detergent isbectwoererno1 asnidv6e.!DeKfaeulet spettdinigsihs 4w. asher

· The higher the number, the more rinse aid the

detergent
Adjusting the rinse

out of the
aid reservoir

Ar·edjauIds3fpcisstohthhCrtieowtnlotedaaogsdtiesis,fnhthtagehhedcreisetjhuuracissrnlrioetiselncestdkh.nsaweoeirditsdeaerdie.anirsdyle.itrnovrgoetihrsp1eecr0aornppveeboxrytliyrhiogrhaerrenumber

until your dishesTaurren stpheotr-infrseeea.id indicator dial to a number between 1 a

TTuhrenhtihgeherirntsheeaniduminbdeicra, tt·ohredmRfAiiaelolmddrteojuuorcanisnentsyiueiotnmauifgibrdtedhttrihehsberheeeTIdetfwhaisrtse,ihrehnegeewhnslisdaageti1shsishchseaaekwernriystddauhawrse6rereeh.nesoi.nutsreomectsbrudtevatrrylo,ieinntrishgyre.opmrroboplrueerelryinosreaaried

the dishwashe spotted, adjust

Adjust lever(Rinse)

If the dishes are not drying properly or are spotdteiadl,taodtjhuestntehxet higher number until your dishes are spot-

dial to the next higher number until your dishesReadreuTcspeuorintt- itffhreteheer.irnesearaeidstiinckdyicwathoirtidshiasl ttaoinasnounmyboeurr bdeisthweeseo

Reduce it if there are sticky whitish stains on yobulruidsihTshhfeielmshoiogrnhaegrlathssewnauremobrerk,ntihfee bmlaodreesr.inse aid the dishw

bluish film on glassware or kAndijufest blelvaedr(Reins.se)

If the dishes are not drying properly or are spotted, a

dial to the next higher number until your dishes are

Reduce it if there are sticky whitish stains on your dis

bluish film on glassware or knife blades.

AAddjujsut lsetverr(iRninssee) level

9 13 13

13

Filling The Detergent Dispenser

Push latch to open

User Manual

20

AB

Rinse Aid & Detergent (Continued)

Filling The Detergent Dispenser

1CSTloPdEsriPseeps3sethn:tehseecrroteovleeoarpsaeenncdatthpcehrecoosnvsetorh.ne

detergent it until

FPSirTleElsPsint1h:egrelTeahseecatDcheontteherdgeteergnentt dDispiesnpserensiet lorcks into place.

to open the cover

Push latch to open

2 Add detergent into the larger c (A) for the main wash cycle . For more heavily soiled wash lo also add some detergent into t smaller cavity (B) for the pre-wa cycle .

AB

1STPErePss2t:he release catch on the detergent

2 Add detergent3··NinOtCiotBPsTlloetoleEehstceteaakinsswtlahegiarnegotmrceoeborasptvcyehelaararbvcvitaeeteny.dddtehipfpefreeemnrsedsanionntnu.gfitaoucnnttuthirleers’soiling of water,

Detergent Dispenser Awdaddsishdpceenytescerlerg.teoFnootrpinmetnootrtheheehceolaavrevgri.leyrscoaivleitdyw(Aa)sfholrot(FaAhod)ersfmmo, raoartlsiehnoehemaaviinlywsNoarieslOehcdocTmwycEalmes:he. nlodaadtsi,ons on the detergent packaging. add some detergent into the smaller cavity a(Bls)ofaodrd some detBeergaewnat rienttohatht edepending on the soiling of water, setting may be different.

the pre-wash cycle.

smaller cavity (B) fPolreathse opbres-ewrvaeshthe manufacturer’s recommendations on the detergent packa

cycle .

open

AB

3 Close the cover and press on it until

it locks into place.

14

on the detergent 2 Add detergent into the larger cavity

cover.

(FNAo)rOfmorTortEeheh:emaaviinlywsoaislehdcwycalesh. loads,
aBlesoaawdadresothmaet ddeepteerngdeinntginotno tthhee soiling of water, setting may be different. sPmleaalsleerocbasveitryve(Bt)hfeormtahneupfarec- twuraesrh’s recommendations on the detergent packaging.

cycle .

ess on it until 14
ing on the soiling of water, setting may be different. nufacturer’s recommendations on the detergent packaging.

21

esatto.house

Cleaning & Maintenance

EXTERNAL CARE

STEP 2:

The fine filter can be pulled off the bottom of the filter

The door seal

assembly. The coarse filter can be detached from the

Clean the door seals regularly with a soft damp cloth main filter by gently squeezing the tabs at the top and

to remove food deposits. When the dishwasher is

pulling it away.

being loaded, food and drink residues may drip onto

the sides of the dishwasher door. The surfaces outside

the wash cabinet and are not accessed by water from the spray arms. Any deposits should be wiped off before the door is closed.

CoMaarisnefilftielrter
Coarse filter

The control panel

Fine filter
Main filter

If cleaning is required, the control panel should be

wiped with a soft damp cloth only.

WARNING

Open

· To avoid penetration of water into the door lock and electrical components, do not use a spray cleaner of any kind.
· Never use abrasive cleaners or scouring pads on
1 tfleihnaHaeivsnooehtul.imdtcSelaootrrmhsckueeskrOwofpcanaopicpstaeheeesrersnbttesoeoucwfruaifelanutlcessleoerm.ctaahknyeytdahlmsreooafytsiaclstrtceaertrac.itthchorthe

1 Hold the coarse filter and rotate it

Fine filter Coa2rseTfhiletefrine filter can be pulled off the

2LfSaLtihaliTnftetrteEigtcdTrhPleiosheurch3nfkewfi:wldotaefeiossriherdnuertprerou.wenumafnnridllniotnscaegaknrntwtdhcseaoacuftniaelttnreo.brf.bFeoerpcaluemallMneoFiaerdniednebTfsotffrbqhoiiohllufyetttmoeetefocrrrerotmiotzhnaihunersosggeimfenhttafghhiilceenttelthfefraiilelactbteaesnrnra,abtbsysethegdmeeentbtotallypyc.haendd

use

baosottfot cmleaonfintghberufislhte. r

pulling
assembly.

it

away.

Lift the filter upwards and out of

The coarse filter can be detached

INTERthNeAdL iCshAwREasher.

from the main filter by gently

1 FiHlteorlidngthSeysctoemarse filter and rotate it

2

Trehateaniftniilsctelcoroincagkrswseyidssteeebmtriosinfurtohnmelobtchakesewthoafesthhfienilgtwecary.schlec.aTbhineet

ccolLolilgfe.tcCttehhdeecckfoiatlthreseercduoenpbdwriitsiaomrndaosyf acthaneudsfieoltteuhrtes orfeilfgteurlsartoly and

Thesqfiuneeefzilitnegr tchaen tbaebspuatllethdeotfof pthaend botptoumllinogf itthaewfialtye.r assembly. The coarse filter can be detached

cltehaen tdhiesmhwif aneshceesrs.ary under running water. Refer
to the following steps to clean the filters in the wash cabinet.

from the main filter by gently 3 sSLqaTruEgePeref4oz:oidnrgemtnhanetstcaabn bseat the top4 aRnedassemble the filters in the reverse

NOTE

pRdcruieluesnaalnnlssiiensnsdgeegmbwmyabibrttilelneyras.,itwnrhgeeapthfylieal.tcfeiletrestrhiunendtfhielreterreivnesresret,oaofrilrndtdedeerrrrinooosftfetarhttth,eeaednidsarsosetamteblcyl,orcekpwlaiscee

the to

Diagrams and pictures in this manual are only for reference, the filtering system and spray arms may appear differently.

cFloorcakmwoirseethtortohueghcclloesaen, aursreoaw.
soft cleaning brush.

the close arrow.

STEP 1: Hold the coarse filter and rotate it anticlockwise to unlock the filter. Lift the filter upwards and out of the dishwasher.

WARNING
Do not over tighten the filters. Put the filters back in sequence securely, otherwise coarse debris could get into the system and cause a blockage. Never use the dishwasher without filters in place. Improper replacement of

the filter may reduce the performance level of the appliance and damage

dishes and utensils.

3 Larger food remnants can be cleaned by rinsing the filter under running water.

4 Reassemble the filtersCinoartshe efilterreverse order of the disassem25blMy,ainrefipltelrace the filter insert, and rotate clockwise to

For a more thorough clean, use a 3 LargsoefrtfcoloeadOnrpienemgnnbarnutssh.can be
cleaned by rinsing the filter under

the close arrow.

Fine filter

4 RWeAaRsNseINmGble the filters in the reverse

o· rdDienorsenoqofut teohnveceerdtsiiegschautsersenelytm,hoebtfhliylet,rewrrsei.spePlucatoctaehrestehfidleteebrsribsack

running wWateAr. RNING

f·ilteNcroeuivnledsreguerstte,intahtnoeddthisrehoswtyaasttseehmecrlawoncidtkhcwoauuitssfeeiltateorbsloinckpalagcee. .

1 HanFsoootlidfrctlaotchclmDoeektaowohcnroenieisnaroewrtgtshtieoosboevrrfueoiclntrsuoehltgoari.ghrcaskhnectldteedhnaereonbtft,hriailuesttesecferio.ilttauelrds.gPeuttinth2toe tfTbhilhotteheetrstesoyfIpdmicsiemnbstlrphoeaefroeosocmsfrepkfmialetataanirenhnrndrrreecdsoucepetfwalceliaqelnnatc.vuseueeiberlmslsneeo.aecfsnpaetsthueobeslmfleleaotcphbdcueplkyrolfiae.iaflgltfnyeec,tre.hmaeanydrdeadmucaegtehe

WARNING Lift theNfieltveerruupswe athrdesdaisnhdwoausthoerf without filtersThine pcloaacres.eImfilpteror pcaenr rbeepldaecetamchenedt of
the dishthweasfihlteerr. may reduce the performance lefrvoeml otfhtehemaapinplfiialtnecrebayngdendtalmy age

Do dniosht eosvaenr dtiguhtteennsitlsh.e filters. Put the filtesrqs ubeaeczkining stehqeuteanbcseastetchueretolyp, and

otherwise coarse debris could get into the psyusltlienmg iatnadwcaayu. se a blockage.

User Manual

22

Cleaning & Maintenance (Continued)

SPRAY ARMS

CARING FOR THE DISHWASHER

It is necessary to clean the spray arms regularly

for hard water chemicals will clog the spray arm

Frost precaution

jets and bearings.

Please take frost protection measures on the

dishwasher in winter. Every time after washing cycles,

SpTboerlacolwyea:anrtmhesspray arms, follow the instructions

please operate as follows:

IstpTSirsoTanyEreeaPcmrem1os:svjaeertysthtaoencdulpebpaenearrtihsnpegrssa.pyraayrmar,mhsorledgtuhlearnlyuftoirnhtahred

water1c.heCtmhueictasolusfpfwpthillylecselooleugcrtcthreiec. al power to the dishwasher at 2. Turn off the water supply and disconnect the

Toctoecnlreetaemnrostvhtieellisatp.nrdayroatrmatse, tfhoelloswprtahyeainrmstrcuoctuionntesrbcelolocwkw: ise

water inlet pipe from the water valve. 3. Drain the water from the inlet pipe and water

valve. (Use a pan to gather the water)

4. Reconnect the water inlet pipe to the water valve.

5. Remove the filter at the bottom of the tub and use

a sponge to soak up water in the sump.

After every wash After every wash, turn off the water supply to the appliance and leave the door slightly open so that moisture and odors are not trapped inside.

Remove the plug

ay

arms

regularlySfporrahyaradrmwaster chemicals will clog the
It is necessary to clean the spray arms regularly for hard

Before cleaning or performing maintenance, always water chemicalsrewmillocvloegtthhee plug from the socket..

spray arm jets and bearings. w the instructionTs1obSceTTlleoEawnPre:t2hme:osvperatyhaermusp,pfoelrloswprtahye ainrsmtr,uctions below2:

To

remove

theNToloocwsleoearlvnseptnrhateys

eaoxrrmtea,rbpiorurallasinvde

cleaning rubber parts

of

the

Tohoreldmtohveentuhteinlotwheercsepnrtaerysatirlml a,npdull out the sopurat ythe spray darismhwupawshaerdr,.do not use solvents or abrasive cleaning

arrmotautpewthaerds.pray arm counterclockwise to remove it.

products. Only use a cloth with warm soapy water. To remove spots or stains from the surface of the interior, use a cloth dampened with water an a little

vinegar, or a cleaning product made specifically for

dishwashers.

arm, till and erclockwise

After prolonged inactivity

It is recommend that you run a wash cycle with the

dishwasher empty and then remove the plug from the

socket, turn off the water supply and leave the door

of the appliance slightly open. This will help the door

seals to last longer and prevent odours from forming

1 2

W stSToThrthoToooouoeaftEltrtamrdsreetPebthmemthmhrt3totehuoehhov:vosesneevehrpuesioattrptth.autroriehnaymgyceuhtashlparlleeyropmiman.ewcnresucesnootpprthuaewrsanerppyatsyrejrteaaridlarctylm.lsnaoa.,ndcrRkdmwwe,piaspleraumcllew2tahteToemourtraeathnmfetdoesvurpersrateihnyeasairlnomwguepr wspawMIvrfreadityort.hhtavieircinmnaa,gtlphpppteuohllilasaeipntaipcoplenipa.mnlIifcuaaesntbcbseoelumteolvyende, ctreysstoarkye, eitpciatninbtehe

3 Wash the arms in soapy and warm

positioned on its back.

water and use a soft brush to clean

Seals

the jets. Replace them after rinsing them thoroughly.

One of the factors that cause odours to form in the dishwasher is food that remains trapped in the seals. Periodic cleaning with a damp sponge will prevent

this from occurring.

d warm to clean rinsing

13
3 Wash the arms in soapy and warm water and use a soft brush to clean the jets. Replace them after rinsing them thoroughly.

23

esatto.house

Troubleshooting

OPERATION IN CASE OF EMERGENCY
In the event of an emergency you should: · Switch off the appliance using the Power button · Switch the clothes dryer off at the power point and unplug the unit. If the power point isn’t accessible,
switch the relevant circuit off at your fuse box/switch board. · Call our support team on 1300 334 357.
ERROR CODES If there is a malfunction, the dishwasher will display error codes to identify these.

Error Code E1 E3

Description
Longer inlet time
Not reaching required temperature.

Cause
Faucets is not opened, or water intake is restricted, or water pressure is too low.
Malfunction of heating element.

E4

Overflow.

Some element of dishwasher leaks.

Failure of communication

Ed

between main PCB with

display PCB.

Open circuit or break wiring for the communication.

WARNING · If overflow occurs, turn off the main water supply before calling a service. · If there is water in the base pan because of an overfill or small leak,
the water should be removed before restarting the dishwasher.

FURTHER PROBLEM SOLVING Before calling for service, review the following:

Issue
Dishwasher will not start

Possible cause

What to do

· Fuse blown, or the circuit · Replace fuse or reset circuit breaker.

break tripped.

Remove any other appliances sharing the same

· Power supply is not

circuit with the dishwasher.

turned on.

· Make sure the dishwasher is turned on and the door

· Water pressure is low

is closed securely. Make sure the power cord is

· Door of dishwasher not

properly plugged into the wall socket.

properly closed

· Check that the water supply is connected properly

and the water is turned on.

· Make sure to close the door properly

and latch it.

Water not pumped · Twisted or trapped

form dishwasher

drain hose.

· Filter clogged.

· Kitchen sink clogged.

· Check the drain hose. · Check coarse the filter. · Check the kitchen sink to make sure it is draining
well. If the problem is the kitchen sink that is not draining, you may need a plumber rather than a serviceman for dishwashers.

User Manual

24

Troubleshooting (Continued)

FURTHER PROBLEM SOLVING CONTINUED

Issue Suds in the tub
Stained tub interior

Possible cause · Wrong detergent. · Spilled rinse-aid.
Detergent with colourant may have been used.

What to do
· Use only the special dishwasher detergent to avoid suds. If this occurs, open the dishwasher and let suds evaporate. Add 1 gallon of cold water to the bottom of the dishwasher. Close the dishwasher door, then select any cycle. Initially, the dishwasher will drain out the water. Open the door after draining stage is complete and check if the suds have disappeared. Repeat if necessary.
· Always wipe up rinse-aid spills immediately.
Make sure that the detergent has no colourant.

White film on inside surface
There are rust stains on cutlery

Hard water minerals.
The affected items are not corrosion resistant.

To clean the interior, use a damp sponge with dishwasher detergent and wear rubber gloves. Never use any other cleaner than dishwasher detergent otherwise, it may cause foaming or suds.
The items should be corrosion resistant.

Knocking noise in the dishwasher

A spray arm is knocking against an item in a basket

Interrupt the program and rearrange the items which are obstructing the spray arm.

Rattling noise in the dishwasher

Items of crockery are loose Interrupt the program and rearrange the items of

in the dishwasher.

crockery.

Knocking noise in the water pipes The dishes are not clean
Cloudiness on glassware. Black or grey marks on dishes

This may be caused by on-site installation or the cross-section of the piping.
· The dishes were not loaded correctly.
· The program was not powerful enough.
· Not enough detergent was dispensed.
· Items are blocking the movement of the spray arms.
· The filter combination is not clean or is not correctly fitted in the base of wash cabinet. This may cause the spray arm jets to get blocked.
Combination of soft water and too much detergent.
Aluminium utensils have rubbed against dishes

This has no influence on the dishwasher function. If in doubt, contact a qualified plumber.
· See notes in “Preparing & Loading Dishes”. · Select a more intensive program. · Use more detergent, or change your detergent. · Rearrange the items so that the spray can
rotate freely. · Clean and/or fit the filter correctly. · Clean the spray arm jets.
Use less detergent if you have soft water and select a shorter cycle to wash the glassware and to get them clean. Use a mild abrasive cleaner to eliminate those marks.

25

esatto.house

Troubleshooting (Continued)

FURTHER PROBLEM SOLVING CONTINUED

Issue
Detergent left in dispenser
The dishes aren’t drying

Possible cause
Dishes block detergent dispenser
· Improper loading · Too little rinse-aid · Dishes are removed too
soon · Wrong program has
been selected. · Use of cutlery with a
low-quality coating.

What to do
Re-loading the dishes properly.
· Load the dishwasher as suggested in the directions. · Increase the amount of rinse-aid/refill the rinse-aid
dispenser. · Do not empty your dishwasher immediately after
washing. Open the door slightly so that the steam can come out. Take out the dishes until the inside temperature is safe to touch. Unload the lower basket first to prevent the dropping water from the upper basket. · With a short program, the washing temperature is lower, decreasing cleaning performance. Choose a program with a long washing time. · Water drainage is more difficult with these items. Cutlery or dishes of this type are not suitable for washing in the dishwasher.

TECHNICAL INFORMATION

User Manual

26

D1

W

TECTHeNIcChALnINicFOaRlMInATfIoONrmation

DIMENSIONS
D1

W

H

H D2

D2

Product fiche
TECHHNeIiCghAt L(HS) PECIFICAT8I4O5mNmS

Width (W)
MDaenputhfa(cDt1u) rer

598mm 600mm (with the door closed)

TyDpeept/hD(De2s)cription 1175mm (with the door opened 90°)

Standard place settings

Height (H) Width (W) Depth (D1) Depth (D2)

815mm 598mm 550mm (with the door closed) 1150mm (with the door opened 90°)

EEsaattttoo EEDWWII660055SS 16 12

Energy efficiency class

3

Water consumption class
32
Standard cleaning cycle

4.5 ECO

Energy consumption of the standard cleaning cycle

0.69 kWh

Water consumption of the standard cleaning cycle

10.2 liter

Program duration of the standard cleaning cycle

170 min

Noise level

49 dB(A) re 1 pW

Mounting

built-in

Could be built-in

YES

Power consumption

1760-2100W

Rated voltage / frequency Water pressure (flow pressure)

AC 220-240V/50Hz 0.04-1.0MPa=0.4-10 bar

27

esatto.house

Purchase Details
For your records, please record details of your purchase below and staple your receipt to this page. Your serial number can be found on the rating plate of your Dishwasher.

STORE DETAILS

STORE NAME |

ADDRESS

|

TELEPHONE |

PURCHASE DATE |

PRODUCT DETAILS

MODEL NO.

|

SERIAL NO.* |

Attach your receipt to this page

User Manual

28

Warranty

WARRANTY TERMS AND CONDITIONS

1. IN THIS WARRANTY

DISHWASHERS

(a) `acceptable quality’ as referred to in clause 10 of

this warranty has the same meaning referred to in

This document sets out the terms and conditions of the

the ACL;

product warranties for Residentia Group Appliances. It is (b) `ACL’ means Trade Practices Amendment

an important document. Please keep it with your proof of

(Australian Consumer Law) Act (No.2) 2010;

purchase documents in a safe place for future reference (c) `Appliance’ means any Residentia Group product

should you require service for your Appliance.

purchased by you accompanied by this document;

(d) `ASR’ means Residentia Group authorised service

representative;

(e) `Residentia Group’ means Residentia Group Pty Ltd

of 165 Barkly Ave, Burnley VIC 3121, ACN 600 546

656 in respect of Appliances purchased in Australia;

(f ) `major failure’ as referred to in clause 10 of this

warranty has the same meaning referred to in the

ACL and includes a situation when an Appliance

cannot be repaired or it is uneconomic for

Residentia Group, at its discretion, to repair an

Appliance during the Warranty Period;

(g) `Warranty Period’ means:

(i) where the Appliance is used for personal,

domestic or household use (i.e. normal

single family use) as set out in the instruction

manual, the Appliance is warranted against

manufacturing defects for 24 months,

following the date of original purchase of the

Appliance;

(h) `you’ means the purchaser of the Appliance not

having purchased the Appliance for re-sale, and

`your’ has a corresponding meaning.

2. This warranty only applies to Appliances purchased and used in Australia and is in addition to (and does not exclude, restrict, or modify in any way) any non-excludable statutory warranties in Australia.

3. During the Warranty Period Residentia Group or its ASR will, at no extra charge if your Appliance is readily accessible for service, without special equipment and subject to these terms and conditions, repair or replace any parts which it considers to be defective. Residentia Group or its ASR may use remanufactured parts to repair your Appliance. You agree that any replaced Appliances or parts become the property of Residentia Group. This warranty does not apply to light globes, batteries, filters, seals or similar perishable parts.

4. Parts and Appliances not supplied by Residentia Group are not covered by this warranty.

— THIS WARRANTY IS VALID IN AUSTRALIA ONLY —

29

esatto.house

5. You will bear the cost of transportation, travel and 10. For Appliances and services provided by Residentia

delivery of the Appliance to and from Residentia

Group in Australia, the Appliances come with a

Group or its ASR. If you reside outside of the service

guarantee by Residentia Group that cannot be

area, you will bear the cost of:

excluded under the Australian Consumer Law.

(a) travel of an authorised representative;

You are entitled to a replacement or refund for a

(b) transportation and delivery of the Appliance to and

major failure and for compensation for any other

from Residentia Group or its ASR, in all instances,

reasonably foreseeable loss or damage. You are

unless the Appliance is transported by Residentia

also entitled to have the Appliance repaired or

Group or its ASR, the Appliance is transported at

replaced if the Appliance fails to be of acceptable

the owner’s cost and risk while in transit to and from

quality and the failure does not amount to a major

Residentia Group or its ASR.

failure. The benefits to you given by this warranty

are in addition to your other rights and remedies

6. Proof of purchase is required before you can make

under a law in relation to the Appliances or services

a claim under this warranty.

to which the warranty relates.

7. You may not make a claim under this warranty

11. At all times during the Warranty Period, Residentia

unless the defect claimed is due to faulty or

Group shall, at its discretion, determine whether

defective parts or workmanship. Residentia Group

repair, replacement or refund will apply if an

is not liable in the following situations (which are

Appliance has a valid warranty claim applicable

not exhaustive):

to it.

(a) the Appliance is damaged by:

(i) accident

12. Missing parts are not covered by warranty.

(ii) misuse or abuse, including failure to properly

Residentia Group reserves the right to assess each

maintain or service

request for missing parts in a case by case basis.

(iii) normal wear and tear

Any parts that are not reported missing in the first

(iv) power surges, electrical storm damage or

week after purchase will not provide free of charge.

incorrect power supply

(v) incomplete or improper installation

13. To enquire about claiming under this warranty,

(vi) incorrect, improper or inappropriate operation

please follow these steps:

(vii) insect or vermin infestation

(a) carefully check the operating instructions, user

(viii) failure to comply with any additional

manual and the terms of this warranty;

instructions supplied with the Appliance;

(b) have the model and serial number of the Appliance

(b) the Appliance is modified without authority from

available;

Residentia Group in writing;

(c) have the proof of purchase (e.g. an invoice)

(c) the Appliance’s serial number or warranty seal has

available;

been removed or defaced;

(d) telephone the numbers shown below.

(d) the Appliance was serviced or repaired by anyone

other than Residentia Group, an authorised repairer 14. You accept that if you make a warranty claim,

or ASR.

Residentia Group and its ASR may exchange

information in relation to you to enable Residentia

8. This warranty, the contract to which it relates and

Group to meet its obligations under this warranty.

the relationship between you and Residentia Group

are governed by the law applicable where the

IMPORTANT

Appliance was purchased.

Before calling for service, please ensure that the steps

in point 13 have been followed.

9. To the extent permitted by law, Residentia Group

excludes all warranties and liabilities (other than

CONTACT SERVICE

as contained in this document) including liability

Service:

1300 11 HELP (4357)

for any loss or damage whether direct or indirect

arising from your purchase, use or non use of the

Appliance.

The Australian Consumer Law requires the inclusion of the following statement with this warranty:

Our goods come with guarantees that cannot be excluded under the Australian Consumer Law. You are entitled to a replacement or refund for a major failure and for compensation for any other reasonably foreseeable loss or damage. You are also entitled to have the goods repaired or replaced if the goods fail to be of acceptable quality and the failure does not amount to a major failure.

— THIS WARRANTY IS VALID IN AUSTRALIA ONLY —

User Manual

30

Warranty (NZ)

NEW ZEALAND WARRANTY TERMS & CONDITIONS DISHWASHER APPLIANCES
To help care for your investment, be sure to register your appliance online. Registration will help you if you need to arrange service in the future, and serves as a record of your purchase–including critical information like model number and serial number ­ that you can refer to at any time. Simply visit the below website, or ask your retailer for help: www.esatto.house/nz/registration

e) defects caused by normal wear and tear, accident, negligence, alteration, misuse or incorrect installations;
f) a product dismantled, repaired or serviced by any serviceman other than an authorised service agent;
g) a product not in possession of the original purchaser;
h) damage caused by power outages or surges

WARRANTY
These products are covered by a warranty for a period of 24 months from the date of purchase, subject to the following conditions*. The warranty covers rectification free of charge of any fault arising from defective materials or components, or faulty workmanship or assembly.

• The conditions above mentioned are:
  1. That the purchaser carefully follows all instructions packed with the product;
  2. That the purchaser and/or installer carefully follows the installation instructions provided and complies with electrical wiring regulations, gas and/or plumbing codes;
  3. That the purchaser carefully follows instructions provided in the owner’s handbook relating to the proper use and care of the product and does not use the product for any purpose other than the domestic use for which it has been designed;

i) damage caused by pests (eg. rats, cockroaches etc.)
7. That if the product is a freestanding microwave oven or small appliance it must be returned to the dealer/ retailer for servicing. These products, unless stated otherwise, have a 12 month warranty from original date of purchase with 24 months on the microwave magnetron; Waste disposers have a 12 month warranty.
8. The provision of service under this warranty is limited by a 25km boundary from the retailer where the product was purchased except for microwaves. Such travelling outside of these limits will incur commercial cost to be paid by you, regulated by the number of kilometres travelled beyond the 25km limit (50km return trip). Microwaves are to be delivered to the nearest authorised service agent by the customer.
Please refer to your user manual for any further conditions that may apply to your specific model.

4. Commercial use of the product for professional or industrial purposes will void this warranty.;
5. That the product was purchased and installed in New Zealand;
6. That this warranty does not extend to:
a) optional glass lids for hobs apart from claims which relate to mechanical or physical damage thereof at the date of purchase;
b) `consumable’ parts such as light bulbs or filters;
c) damage to ceramic glass caused by liquid or solid spill-overs, lack of maintenance, or impact;
d) damage to surface coatings caused by cleaning or maintenance using products not recommended by the owner’s handbook;

Nothing herein contained shall be construed in any way as excluding or limiting your rights under the Consumer Guarantees Acts 1993.
For Service please visit www.applico.co.nz/service or contact the dealer/retailer from whom you purchased the product from or call the 0800 number listed below. If you are unable to establish the date of purchase, or the fault is not covered by this warranty, or if the product is found to be in working order, you will be required to bear all service call charges.
Registration of this warranty constitutes acceptance of the terms and conditions of this warranty.
Should you require any assistance, please call Customer Services on 0800 763 448.
Distributed by Applico Ltd. www.applico.co.nz July 2019

After registering your appliance online, we recommend you fill out the below information for your reference and keep this warranty card in a safe place.

— THIS WARRANTY IS VALID IN NEW ZEALAND ONLY —

31

esatto.house

This page is intentionally blank.
But if you want to draw something, make notes or even write a recipe, it’s all yours!

everything you need
A RESIDENTIA GROUP INITIATIVE

References

• Applico
• Applico

Read User Manual Online (PDF format)

Read User Manual Online (PDF format)  >>

Download This Manual (PDF format)

Download this manual  >>